Skip to content
  • About Us
    • Home
    • About Editor -in-Chief
  • INTERNATIONAL
    • International
  • Bureaucracy Updates
    • PSU
  • Current News
  • State
  • Corporate
  • Central Government Schemes
  • Latest News
  • Excl. Interviews
  • Post your coverages
  • About Editor -in-Chief
  • Converse with Tarun – Exclusive Video interviews
  • Health & Fitness
    • Health & Fitness
  • Advertise with us
  • PSU
  • Diplomacy News
  • Events
TOP INDIAN BUREAUCRACY NEWS | SARKARIMIRROR

TOP INDIAN BUREAUCRACY NEWS | SARKARIMIRROR

India’s top bureaucracy news portal, read the latest insider from the world of bureaucracy, politics, PSUs, defence and corporate, updated round the clock

  • About Us
    • Home
    • About Editor -in-Chief
  • INTERNATIONAL
    • International
  • Bureaucracy Updates
    • PSU
  • Current News
  • State
  • Corporate
  • Central Government Schemes
  • Latest News
  • Excl. Interviews
  • Post your coverages
  • About Editor -in-Chief
  • Converse with Tarun – Exclusive Video interviews
  • Health & Fitness
    • Health & Fitness
  • Advertise with us
  • PSU
  • Diplomacy News
  • Events

Flash News

सुचेता कृपलानी की 51वीं पुण्यतिथि  (1 दिसम्बर) पर स्मृति व्याख्यान 

Finnish Ambassador Lähdevirta Reinforces India Partnership, Bolstering Sustainable Investment and Trade Ties Ahead of India-EU FTA

Swiggy & Curefoods Join hands to Launch Exclusive High-Protein Campaign Across India

The Cabinet Committee on Economic Affairs (CCEA) approves disinvestment of...

Arvind Kumar selected for the post of Director (Finance), National Fertilizers Limited (NFL).

Wednesday, December 10, 2025

Tag: government contact directory

PNB SOUTH DELHI CIRCLE PARTICIPATES SWACHH BHARAT ABHIYAN
PSU

PNB SOUTH DELHI CIRCLE PARTICIPATES SWACHH BHARAT ABHIYAN

sarkarimirror March 7, 2015

New Delhi: Punjab National Bank, South Delhi Circle participated in Swachh Bharat Abhiyan by renovating the girl student’s toilet complex at Government Middle School, village Jajru, Dist. Faridabad. The programme … Read More

. The Minister of State for Road Transport & Highways and Shipping P. Radhakrishnan‘National conference on Strengthening of Cooperative - Education and Training system“Beti Bachao14th World Toilet Summit 2015150th birth anniversary celebrations of Sir Ashutosh Mookerjee15th International Seminar on “Counter IED Strategy15th International Seminar on “Counter IED Strategy by nsg19th convocation Ceremony of NIMHANS2013-2022 in New Delhi2015. The Vice Chairmen of NITI Aayog20th Meeting of the Central Zonal Council21st International Conference & Exhibition on Terrestrial and Satellite Broadcasting24th Admiral R.D. Katari Memorial lecture29th Arunachal Statehood Day29th Arunachal Statehood Day function29th meeting of the Central Consumer Protection Council400kV GIS sub-station44th Battalion Rashtriya Rifles4th India International Potato Expo-201553rd Annual Session of Cement Manufacturers’ Association66th republic day celebration of india66th Republic Day of india67th army day7th Vibrant Gujarat Global Summit 20158th National Biennial Awards for Grassroots Innovations and outstanding Traditional KnowledgeA. SethumadhavanA. Sethumadhavan chairman of national book trust of indiaA.K. MitalaajtakAAM AADMI PARTYAAMER ZAKIRAAMER ZAKIR INTERVIEW IN SARKARIMIRRORAAMER ZAKIR INTERVIEW WITH TARUN SHARMAAAMER ZAKIR INTERVIEWSAAMIR KHANaapAAP LEADER ASHUTOSHAcute Encephalitis SyndromeAdditional Member (Commercial) Railway BoardAdditional Secretary (Centre-State)Addl Secy. (Health)Adi Sankara’sAdi Sankara’s lifeAdmiral Harry HarrisAdmiral R.D. KatariAdmiral R.K. DhowanAdvocates' Association of Western IndiaAero India-2015Aero India-2015 Air ShowAESafr of psuAGMagm of psuagricukture newsagricultureAgriculture Minister of Israelagriculture newsaiccaicc chiefAir Chief Marshal Arup RahaAir Marshal J.S. Klerairline operators in indiaairlines in indiaAjay ShuklaAkbar Torkanakhilesh yadavAll India Citizens’ Alliance for Progress & DevelopmentALL INDIA CRIME NEWSAll India Federation of the Deaf’All India Federation of the Deaf’ PresidentAll India Federation of the Deaf’ President Kum. Surrender SainiAll India Shwetamber Sthanakvasi Jain ConferenceAll India Shwetamber Sthanakvasi Jain Conference presidentAll India Shwetamber Sthanakvasi Jain Conference spiritual mahakubh indoreAll India Shwetamber Sthanakvasi Jain Conference spiritual mahakumbhAmar Jawan JyotiAmbassador of China to Indiaambassadorsambassadors of indiaambassadors of various contries in indiaambassadors to indiaambassadors to india from across the globeamitabh kantAmitabh Kant secretaryanandiben patelanant GeeteAnanthkumarAnil SwarupANMAnti LeprosyAnti Leprosy dayAnti Leprosy FortnightAnti Leprosy weekApplicationsarack Obama inspecting the Guard of Honour during india visitarmuy daiAROON PURIEarun jaitleyArunachal Statehood DayArundhati Bhattacharyaarvind kejiwalarvind kejriwal delhi chief ministerArvind Panagariyaashok chakraAshok Gajapathi Raju PusapatiAshok LavasaASHUTOSHasia newsasian development bankASSOCHAMAssociate professor Department of biochemistryAssociation of Chambers of Commerce& Industries in IndiaAt Home` reception of US President Barack obama in new delhi oon 66th india republic dayat the inauguration of the DGNCC Republic Day Camp 2015at the World Book Fairat the World Book Fair-2015AUDITED FINANCIAL RESULTS OF NATIONALISED BANKS OF INDIAaustralian senatorautonomous bodies of indiaaviation newsB S BASSIB.P. SharmaBabul Supriyobabusbabus of indiaBAE Systemsbahrain newsbahujan samaj partyBalmerLawrie& Co. LtdBan Ki-moonBand performing at the Beating the Retreat CeremonyBand performing at the Beating the Retreat Ceremony at rashtrapati bhavanBandaru DattatreyaBangaloreBank MitrBANKSbanks in indiaBarack Obamabarack obama india visit on republic dayBarack Obama paying floral tributes at the Samadhi of Mahatma Gandhibaramati newsbasic needsbbcBC AGENTSBCCI CHIEFbeating retreatbenefits the societyBengal Global Business SummitBES EXPO-2015BEST BANKS OF INDIAbest diplomacy newsbest diplomacy websitesBEST DOCTORS OF SIR GANGA RAM HOSPITALbest entertainment newsbest news of indiabest news websitesbest political sitesbest political websitesbest political websites of indiabest Road Safety PracticesBeti hai to kal haiBeti Padhao logoBHARAT ELECTRONICS LTD.Bharat Rang MahotsavBharat Rang Mahotsav organised by National school of dramaBhuj newsBhupendrasinh M. Chudasamabhutan newsBicentenary Celebrations of Gorkha Riflesbimal julkaBimal Julka inaugurating the Display of Publications Division’s books at the World Book Fair-2015Birth Anniversary Celebration of Swami VivekanandbjpBJP PRESIDENTboard members of indian railwaysbodhi plantbollywood newsBollywood starsbombay high court museum officialsBook of the Institute of Indian LanguagesBook of the Institute of Indian Languages Mysorebook on Adi Sankara’s lifebook on Adi Sankara’s life and teachinsbook Quarterdeckbook release India–2015 Reference Annualbooks by northern railwaysbooks published by northern railwaysborder haatborder hatt at srinagarBorder Security ForceBranding ideasbreaking newsbreaking news of indiaBRICS International Youth Forum 2015britains BAE Systems for Indian Air ForceBSEbse quotesbspbudget session of parliament of india 2015bureaucracybureaucracy todaybureaucracy today in indiabureaucratsbureaucrats in indian politicsBUREAUCRATS NEWSbureaucrats of indiaBusinessbusiness entertainment news in ENGLISH about india local news onlinebusinessworldC.K. Mishracabinet ministers of indiaCadet Sergeant Shubham Bairagicadets from Jammu & KashmircaraCENSER BOARD CHIEFCENSOR BOARD OF INDIACentenary Celebrations of by Zoological Survey of IndiaCentenary Celebrations of ZSIcentral government directorycentral government newscentral government of indiaCENTRAL RAILSIDE WAREHOUSING CORPORATION LTD.CEO DELHI JAL BOARDCEO DJBceo helpage indiaCEO OF DELHI JAL BOARDceo poscoCEO-Designate Allianz Group of GermanyChairman and Managing Director of National Research Development Corporationchairman of hindustan aeronauticals ltdchairman of national book trustchairman of psuchairman of visitbritainCHAIRMAN SPEECH OF GOVERNMENT BANKS OF INDIACHAIRMAN SPEECHES OF BANKS IN INDIAchairmans of psuCHAIRPERSON SBICHANDIGARH NEWSChaudhary Birender Singhchennai newsChhattisgarhCHIEF ELECTION COMMISIIONERchief justice of indiachief manager of psuChief Minister of GujaratChief Minister of HaryanaChief Minister of KeralaChief Minister of Madhya Pradeshchief ministers of indiachief ministers of statesChief of Army Staffchief of the air staff indiachina newsCHRISTIAN COMMUNITY NEWS IN INDIAChristopher Rodriguezcitation for the Best Service Hospital to Command Hospital (SC)Citizen Journalistcivil aviation minister of indiacivil aviation newsclosing ceremony of the National Tribal Festival- 2015 VANAJcm akhilesh yadavcm delhi inaugrates dwarka water treatment plantCMDcmd air indiacmd bhelcmd bsnlcmd delhi tourismcmd ficcicmd gailcmd hudcocmd irconcmd irctccmd licCMD MTNLcmd nalcocmd national insurancecmd nhpcCMD NRDCcmd ntpccmd obcCMD of Biocon Limitedcmd of indian psucmd of psucmd of psu of indiacmd ongccmd oriental bankcmd pnbCMD POSCO INDIAcmd powerfinancecmd powergridCMD Punjab & Sind Bankcmd railtelcmd reccmd ritescmd sailcmd scicmd sidbicnbcCNN IBN EDITOR ASHUTOSHCoal and New & Renewable EnergyCoal and New and Renewable EnergyCoal and New and Renewable Energy the Minister of State (Independent Charge) for PowerCoal and NRECol. Rajyavardhan SinghCol. Rajyavardhan Singh RathorecolumnCOMEDIAN KAPIL SHARMAComedy Nights With Kapil.CommerceCommunicationsComputerconference on pahalcongresscongress partyConnectivityCONSTABLE AJMERSINGHConstitutionconsulate of indiaConsultative Workshop on Urban GovernanceContest for PMO Mobile App developmentController General of Defence AccountsCorporate Affairs and Information & BroadcastingCosmology and Astrophysics Research Group Centre for Theoretical Physicscpwdcpwd newscpwd tableau at rajpath on republic dayCRIME NEWScurremnt newcurrent affairscurrent affirscurrent chairman of hindustan aeronauticals ltdcurrent cmd of ntpccurrent newscurrent speaker of lok sabhaCzech RepublicD.V. Sadanandadare devil stunts of motorbike riders of Border Security ForceDASDatacentersdefence newsdefence personnels of indiaDefence Researchdefence websites of indiadefenseDelhi Administration Subordinate Service Cadredelhi assemblydelhi assembly elction newsdelhi assembly elections 2015delhi assembly elections latest newsDELHI CHIEF MINISTERdelhi crime newsdelhi deputy chief ministerdelhi economic surveydelhi governmentdelhi government newsdelhi jal boarddelhi jal board ceoDELHI JAL BOARD CHAIRPERSONDELHI JAL BOARD DWARKA WATER TREATMENT PLANTDELHI JAL BOARD HEAD OFFICEdelhi jal board newsDELHI NEWSdelhi policedelhi police commissionerDELHI POLICE EAST DELHIdelhi police head quarterdelhi police head quartersDELHI POLICE SPECIAL STAFFDELHI POLLSDELHI POLLS DATEDELHI TRANSPORT ROAD SAFETY WEEKDELHI TRASPORT NEWSDELHI WATER SUPPLIERSdeli police newsDepartment of Atomic EnergyDepartment of Electronics and Information TechnologyDepartment of Empowerment of Persons with DisabilitiesDepartment of Financial ServicesDepartment of Industrial Policy and PromotionDepartment of Spacedeputy chief minister of delhiDeputy Prime Minister of PolandDevelopment and Technology CooperationDevendra FadnavisDGDG (Inspection & Safety)dg J. N. Chakarvatidg nccDG NCC Republic Day Camp 2015dg nsgDGNCC Republic Day Camp 2015Dharmendra Pradhandiplomacy websitesdiplomacy websites in indiaDirector GeneralDirector General (M&C)directory of central governmentdirectory of embassies consulates in indiadirectory of government of india officialDisaster ManagementDiscussion boardDistrictsDivya Singh Deo GajapatiDJB introduces Online Complaint Registration and Status Check Facility for its consumersDoordarshandr m ravikantDr. A.P.J. Abdul KalamDr. Amita GuptaDr. Arup Roy ChoudhuryDr. Arvind SubramanianDr. C. ChandramouliDr. H. PandaDr. Hanumanthu PurushothamDr. Jitendra SinghDr. K.K. PaulDr. Kellie LeitchDr. Lalit K. PanwarDr. Mahesh SharmaDr. Najma A. HeptullaDr. P. BalaramDr. P. C. KokilaDr. Rajendra Prasad Sarvodaya VidyalayaDr. Rakesh KumarDr. Raman SinghDr. Syed Nasim Ahmad ZaidiDr. Tony Tan Keng YamDr.RAM .S.SANGAPUREDrinking Water and Sanitatione governanceE-book of Ministry of EnvironmentEconomic Growtheconomic surveysEconomicsED GAURI SHANKAREducationeducational institutes in greater noidaeIndiaEknath Khadseelection commisiionELECTION COMMISSIONELECTION COMMISSION OF INDIAelections model code of conductElectoral Roll databaseembassies abroad indiaembassies in delhiembassies in indiaembassies of indiaENGLISH newsENTERTAINMENT NEWSEnviornmentEnvironmenterickshawserickshaws association in delhierickshaws in delhiesic chennaiethiraj college for womeneurope newseuropre newsEXCHANGE4MEDIAExecutive Director PUNJAB NATIONAL BANKExternal Affairs and Overseas Indian Affairsfarmers newsFarmers RallyFarmers Rally at baramatiFASHION DESIGNER AAMER ZAKIRfashion designers in indiafather of nation mahatma gandhiFederal Assembly of Russian FederationFICCIFijiFINANCEfinance newsfinancial institutes in indiaFINANCIAL RESULTS OF BANKSFirst Lady Michelle ObamaFirst Visitors Award-2015 for the Research 2015flying Russian origin Yak aircraftFood and Public Distributionforeign ambassadors in indiaforeign embassies and consulates in indiaForest and Climate ChangeForests and Climate ChangeFORMER JOURNALIST SANTANU SAIKIAfoundation day of NCPCRFoundation Stone laying Ceremony of the Centre of Excellence for Vegetable Development in BaramatiFoundation Stone laying Ceremony of the Centre of Excellence for Vegetable Development in Baramati by prime minister of indiaFrench Defence Ministerfull dress rehearsal for the Republic Day Parade-2015Fumio KishidaG.M. Siddeshwaragallantry award Ashok ChakraGandhigandhi familyGandhi Peace FoundationGandhi SmritiGANDHINAGARGANDHINAGAR NEWSgauri shankarGee Woong SungGeneral (Retd.) V.K. SinghGeneral Budget 2015-16General Dalbir SinghGENERAL KNOWLEDGEGeneral Managers PR of psuGeneral Zhang YouxiaGermanygermany newsgfilesindiagiriraj singhGISGLOBAL NEWSglobal news websitesgm of psugoernment of jaipurGoIgoi officialsGolden Jubilee Celebrations of R.V. College of Engineeringgorkha riflesgovernancegovernance newsgovernance nowGoverning Council of NIITI Aayoggovernment contact directorygovernment contact listgovernment contactsgovernment directorygovernment jobsGOVERNMENT JOBS IN INDIAGovernment Law CollegeGovernment Law College Mumbaigovernment newsgovernment news indiagovernment news of indiaGOVERNMENT OF DELHI NEWSGOVERNMENT OF GUJARATgovernment of indiaGovernment of india contact numbersgovernment of india newsgovernment of india news todaygovernment of india official contactgovernment of india official contact detailsgovernment of india official contact numbersgovernment of india official contactsGOVERNMENT OF INDIA OFFICIALSgovernment of india officials newsgovernment of india telephone directorygovernment of india websitesGovernment of Madhya PradeshGOVERNMENT OF NCT OF DELHIGovernment of RajasthanGovernment of the People's Republic of Bangladeshgovernment phone directorygovernment psu of indiaGOVERNMENT PSU OF INDIA NEWSgovernment telephonegovernment telephone directorygovernment telephone numbersgovernment tendersgovernnanceGovernor of UttarakhandGovt IssuesGuard of Honour during the presentation of Standards to 21 SQN & 116 HU of Indian Air Force in Jodhpurgujaratgujarat newsGujarati Association malaysiaGujarati AssociationsGujarati translation of ThirukkuralH.S. BramhaHALhal bangalorehamid ansarihamid ansari office addressHansraj Gangaram Ahirhappening news of indiaHaribhai Parathibhai ChaudharyHARISHANKAR BRAHMAHAWK MK 132 simulatorhe Minister of State for Development of North Eastern RegionHead of General Armament Department of the PLA and the member of CMChead quarters of delhi policeheadlines in cricketheadlinestodayHeads of Mission Conferenceheads of psu of indiahealth issueshealth newsHealth Sustainabilityhelpage indiaHelpline for Drug De-AddictionheritageHeritage City Development and Augmentation Yojanahigh commission in delhihigh commission in new delhihighlights of union budgetHIGHLIGHTS OF UNION BUDGET 2015Hight CourtHind Kusht Nivaran Sanghhindustan aeronauticals ltdhindustan aeronauticals ltd chairmanHindustan Aeronautics LimitedHindustan Aeronautics Ltdhindustan timeshindustan times epaperhome minister of indiahome secretary L.C. Goyal.who is the home secretary of indiahorticulturehorticulture newshorticulture updtaeshospitalsHotel TridentHousing and Urban Poverty AlleviationHousing and Urban Poverty Alleviation and Parliamentary AffairsHRIDAYHTT-40 trainerhuco newsHUDCOhudco bhawan at new delhihudco bhawan at salt lakeHUDCO CMDHUDCO NEWShudco office in new delhiHuman RightsHYDERABAD NEWSIAASiafIAF Republic Day Parade 2015 marching contingentiariIASias dr m ravikantIAS HARISHANKAR BRAHMAIAS OFFICERSias officers of indiaias preparationsIBAIBA BANKING TECHNOLOGY AWARDibn7ibn7 nwsibnliveIESIFoSifsiisimphal newsIMTEX and Tooltech-2015in New Delhiin New Delhi on February 08inadian army newsinaugration of delhi jal board water treatment plant by arvind kejriwalinaugration of India Water Week 2015inaugration of Multimodal Manufacturing Project of GEinaugration of Multimodal Manufacturing Project of GE by narendra modiinaugural ceremony of the 63rd All India Police Wrestling Cluster 2014-15inaugural ceremony of the 63rd All India Police Wrestling Cluster 2014-15 organised by itbpinaugural session of the 14th World Toilet Summit 2015inauguration of the 7th Vibrant Gujarat Global Summit 2015inauguration of the AIR Chennai’s broadcast of Vividh Bharati on FM channelinauguration of the National Meet on Adoptioninauguration of the New Railway Line between Hazaribag and Kodarma in Jharkhandinauguration of the Oil & Gas Conservation Fortnight of PCRA 2015inauguration of the Public Art Innovation on sustainability “Ganga Waterfront”INCOME TAXincome tax commissionerincome tax departmentincome tax department of indiaincredible indiaindiaindia 7th Agricultural Summitindia air chiefindia best bureaucracy websiteindia best english news websitesindia best news websitesindia best political newsindia best political news websiteIndia Breaking Newsindia bureaucratsINDIA CENSOR BOARDindia chief justiceINDIA CHRISTIAN COMMUNITY NEWSindia civil aviation ministerindia civil aviation newsindia curent affairsindia current affairindia current affairsindia defence newsindia election newsindia fashion newsIndia Gateindia general newsindia home ministerindia horticulture newsindia ias officersindia international newsIndia International Potato ExpoIndia International Potato Expo-2015india khadi industriesindia latest newsindia list of ias officersindia list of ips officersindia nationalised banksindia netasindia newsindia news websitesindia parliament houseindia parliamentariansindia parliamnet newsindia police commissionersindia political newsINDIA POLITICAL PARTIESindia prominent scientistsindia railways tableau at 66th republic dayINDIA REPUBLIC DAYindia republic day beating retreatindia republic day newsindia resultsgovernment jobsindia sarkari babusindia sarkari newsindia Sikh Regimentindia space research organisationindia state governmentsindia todayindia top banksindia top bureaucratsindia top government news websitesindia top n ewsindia top newsindia top news websitesindia top political sitesindia top psu newsINDIA TOP TEN BANKSindia top ten news websitesindia updated newsindia vice presidentindia votersIndia Water Week 2015India-US Strategic DialogueIndia–2015 Reference AnnualIndia–2015 Reference Annual book releaseIndia’s new visa shift and synergies between Britain and Indiaindia’s top 10 bureaucratsINDIAN ADMINISTRATIVE SERVICESIndian Agricultural Research Instituteindian air forceindian air force newsindian ambassador to the united statesINDIAN AMBASSADORSindian armyindian babusINDIAN BANKING ASSOCIATIONINDIAN BUREAUCRACTSindian bureaucracyindian bureaucrats blogINDIAN BUREAUCRATS LISTIndian Coal Story – Prospects and Challengesindian defence newsindian diplomacyINDIAN DIPLOMATSindian diplomats contact numberindian diplomats newsIndian Economyindian embassyindian financial instituesindian governanceindian governance top news websitesindian governmentindian government contactindian government contact detailsindian government contact numbersindian government dirctoryindian government home secretaryindian government newsindian government official websiteindian government phone directoryindian government websitesindian ias officersindian militaryindian military newsindian national congress partyINDIAN NAVRATNASindian ngoindian nri newsINDIAN POLICE SERVICESIndian political newsindian politicsindian politics newsINDIAN PREMIER LEAGUEIndian PSUindian psu headsindian railway boardindian railway board membersindian railway budgetindian railway budget 2015indian railwaysindian railways newsindian railways officialsindian states newsindiatodayindira gandhiIndo Tibetan Border Police ForceINDO-US RELATIONSHIPIndustrial and SEZsIndustriesInformation TechnologyinfrastructureInia Batikoto SeruiratuInstitution of Permanent Way EngineersintegratedINTELECT-2015 & UPTO 11kv exhibitionINTELECT-2015 & UPTO 11kv international exhibitionIntermediate Jet TrainerInternational Customs Day 2015international government newsinternational Gujarati Associationsinternational newsinternational news websitesInteroperableINTERVIEWS OF TOP FASHION DESIGNERS OF INDIAInveInvestiture Ceremony 2015IPLIPSipweipwe indiairsISROisro chiefITit minister of indiait ministryitbpitbp newsITSJ. N. ChakarvatiJ. N. Chakarvati dgJagat Prakash NaddaJaguar Darin-IIIjaipur newsJamia Milia IslamiaJammu and Kashmir newsJammu UniversityJan MladekJanusz Piechocinskijapan newsJapanese EncephalitisJayant SinhaJayanthi SirisenaJEJean Yves Le DrianJHARKHAND NEWSJim Yong KimJitan Ram Manjhijohn kerryJoint SecretaryJoint Workshop on Skill Development and EntrepreneurshipJoint Workshop on Skill Development and Entrepreneurship in new delhiJone UsamteJoon-Gyu LeeJS (RMNCH+A)Jual Oramjual ramK BISWALK U THANKACHANK. RadhakrishnanK.V. Brahmaji RaoKailash Mansarovar Yatra 2015Kailash SatyarthiKalraj MishraKamarajar Port Ltd.Kapil SharmaKAPIL SHARMA COMEDIANKarnataka & GoaKeshari Nath TripathiKhadikhadi gramudyogkhadi industry in indiakhadi newsKiran Kumar Alur SeelinKiran Mazumdar ShawKiren RijijuKMY website & bilingual Interactive Voice Response System (IVRS)kolkata newsKolkata.Krishan PalKrishna TirathKRISHNA TIRATH DALIT LEADERKum. Surrender SainiKwon Oh-JoonL.C. GoyalLALU YADAVlatest amabassadors of indialatest baramati newslatest bureaucrats newslatest bureaucrats of indialatest chairperson of delhi jal boardlatest china newsLATEST CRIME NEWSlatest defence newslatest delhi government newslatest delhi jal board newslatest europe newslatest fashion newslatest finance newslatest government newslatest high commisions in indialatest hudco chairmanLATEST HUDCO CMDlatest hudco newslatest ias officerslatest india newslatest indian railways newslatest internationla newslatest ips officerslatest itbp newslatest jharkhand newslatest military newslatest ncc newsLatest Newslatest news from indialatest news of government of madhya pradeshlatest news of indialatest ntpc newsLATEST PATNA NEWSlatest political newslatest political news indialatest political news of indialatest prime minister of indialatest psu newslatest railway budgetlatest rss newslatest water newslatest world newslatets crime newslatets enws of indialaunch of the “2015 – Year of Active Pharmaceutical Ingredientslaunch of the Venture Capital Fund for Scheduled CastesLawrence WongLe YuchengLEANDER PAESLEELA SAMSONLEELA SAMSON CENSER BOARD CHIEFLeprosy Seal CampaignLight Combat AircraftLight Combat HelicopterLight Utility Helicopterlisa singhlist of ambassadors in indialist of chief ministers of statelist of cmd of india psulist of diplomatic missions of indialist of indian bureaucratslist of top navratnasLord Ian LivingstonLov VermaLt Gen V.K. SaxenaLt. Gen. A. ChakravartyLt. Gen. Aniruddha ChakravartyLt. General (Retd.) Shri A.K. Singhlucknow newsm-Governmentmadhuri dikshitmadhya pradesh chief ministermadhya pradesh newsmadras high courtmadras high court newsMahabodhi templeMaharaja of Purimaharajas of jaipurmaharshtra mla’smahatma gandhimahatma gandhi statuemahatma gandhi statue at gandhinagarMaite Nkoana-MashabaneMaithripala SirisenaMajor Mukund VaradarajanMajor Mukund Varadarajan 44th Battalion Rashtriya RiflesMANAGING DIRECTOR CRWCManeka Sanjay GandhimangalyaanManik Sarkarmanipur newsmanish sisodiaManjula ChellurManohar Lal KhattarManohar ParrikarManoj SinhaMartina HingisMartina Hingis and Leander Paesmartyr's dayMARY KOMMary Tanmatdan mahotsavMathews Cherian ceoMathews Cherian ceo helpage indiaMathribhasha DiwasMathribhasha Diwas celebrationsMaumoon AbdulMCC Chamber of Commerce & IndustryMCC Chamber of Commerce & Industry kolkatamcdmcd commissionermcd newsmeeting of the Central Consumer Protection CouncilMehmetMember of Parliament.Member Trafficmembers of parliament of indiaMHAMilitarymilitary newsminister giriraj singhMinister of State for Culture (Independent Charge)Minister of State for Trade & Investment of UKMinister of State with Independent Charge for Powerministers indiaministers of indiaministries and departmentsministries contact numbersministries of govt. of indiaMINISTRIES OF INDIAministry for developmentMinistry of CoalMinistry of CultureMinistry of FinanceMinistry of Home AffairsMinistry of Information and Broadcastingministry of msmeministry of petroleumMinistry of Petroleum & Natural GasMinistry of PowerMinistry of ShippingMirage upgradeMLAmla’s of indiamodel code of conductmodel polling boothMODI LUNCH AT PARLIAMENT CANTEENMODI TAKING LUNCH AT PARLIAMENT CANTEEN NEWSmohan bhagwat latest newsMOHFWMOTHER TERESAmotorbike riders of Border Security ForceMOU BETWEEN BalmerLawrie& Co. Ltd & Controller General of Defence Accountsmou between Kamarajar Port Ltd. & Toyota Kirloskar motor PvtMr. H.H. Moran Mor Ignatius Aphrem IIMridaparikshak Lab (for Soil Analysis) at Indian Council of Agricultural ResearchMridula SinhaMrs. S. Ramsay editor of quarterdeckmsmemsme awardsmsme minister kalraj mishramsme minister of indiaMufti Mohammad SayeedMughal Gardens of Rashtrapati BhavanMukhtar Abbas NaqviMultimodal Manufacturing Project of GEMumbaiMUMBAI NEWSmumbai policemumbai political newsmunicipalities of various states of indiaMurli Deora ckowkMysoremysore newsN SRINIVISANN. RangaswamyN.N. VohraNarendra Modi having 'Walk the Talk' with the US PresidentNarendra Modi in ‘One on One’ Talks on the tea with the US PresidentNariman Point MumbaiNation-Wide inaugural ceremony of Value Education organised by Ramakrishna MissionNational Awards for the Best Electoral Practicesnational book trustnational book trust of indiaNational Bravery Award winnersNational Bravery Award winners 2014National Bravery Award-2015 winner childrenNational Bravery Award-2015 winner children with vice president of indiaNational Conference on Animal Taxonomy–Challenges and ProspectsNational Conference on Animal Taxonomy–Challenges and Prospects organised by Zoological Survey of IndiaNational Conference on Development & Export of SpicesNational Conference on Strengthening the Economy through Judicial Reformsnational congress partyNational Disaster Response ForceNational Meet on Adoptionnational school of dramanational security guardNational Skill Development Corporationnational stock exchangeNational Tiger Conservation AuthorityNational Voters’ DayNational youth Daynationalised banks of indianavratnasnavratnas listNCCncc cadetsncc dgncc newsncc rallyNCC Republic Day Parade CampNCC Republic Day Parade Camp 2015ncpncp partyncpcrndmcndrfndtvnetasnetas of indiaNetworkingNew DelhiNEW DELHI NEWSnew Member Mechanicalnewsnews about indianews about states of indianews of different states of indianews of indianews of psu’s of indiaNEWS ON WATER SUPPLIERS OF DELHInews online latest news in ENGLISHnews todayNews Updatenews website latest NEWS photos videos news breaking news in ENGLISHnews websitesNGO IN INDIANGOsNicola GruevskinimhansNirmala SitharamanNISGniti ayogNobel Peace LaureateNoida Shaheed Smarak.Nokianokia newsnorth block of rashtrapati bahavanNorth Eastern Region MSMEs Conclave 2015northern railwaysnorthern railways newsNRDCnrinsdnsense mumbainse quotesnsgNSS VolunteersNTPCntpc cmdNTPC K BISWALntpc ladies clubntpc ladies club newsntpc newsO.P. Kohliofficial directory of government of indiaOil & Gas Conservation FortnightOil & Gas Conservation Fortnight-2015oil psuOkram Ibobi SinghOliver-BaeteOm Prakash Dhankaromar abdullahOommen Chandyorganised by the eminent artist Manav GuptaP. RadhakrishnanP.C. Agarwal Secretary HKNSP.V. RajagopalPacific Fleet US NavyPanchayati RajparliamentParliament HouseParliament newsparliament of indiaparliament of india newsParliamentariansParliamentarypassportpassport applicationPATNA NEWSPaul PolmanPay CommisionPCSPedro Morenes EulatePenny PritzkerPeoplePersonnelPETROLEUM MINISTRYpgcilphone directoryphone number of indian govtphone numbers of government of indiaphone numbers of indian government employeesPinaka 214 MM Multiple Barrel Rocket Launcher SystemPiyush GoyalPlenary Session III of Youth Pravasi Bharatiya Divas 2015PMNRFPMO Mobile App developmentpnbPNB DOCUMENTARY FILMPNB DOCUMENTARY FILM VARDAANpnb ed gauri shankarPNB EXECUTIVE DIRECTORPNB PrernaPNB SOUTH DELHI CIRCLEPNB supported Hind Kusht Nivaran Sangh for leprosy eradicationpoland newsPOLICE COMMISSIONER B S BASSIpolice commissionerspolice commissioners listPoliciesPolicyPOLIO DROPSpolio in indiapoliticalpolitical newspolitical news of indiapolitical parties in indiapolitical sitespolitical websites of indiapoliticspolitics newsPopulationport blairport blair newsposcopower gridPower Grid Corporation of India Limitedpower persona of the year awardspower psupower psu newsPower Solutionspowerful bureaucrats of indiaPrakash MishraPravasi Bharatiya DivasPravasi Bharatiya Divas 2015Pravasi Bharatiya Samman Awardspremier banks of indiapresident assochampresident ficciPresident Gorkha Brigade and Colonel of the Regiment 5 Gorkha Riflespresident of india administering polio dropsPresident of World BankPresident's EstatePress Information Bureauprime minister national relief fundPrime Minister of Bhutanprime minister of indiaprime minister of polandPrime Minister's NCC RallyPrime Minister's Officeproducer Dinesh VijanProf. (Dr.) Ram Shankar KatheriaProf. Anjan Ananda SenProf. Kaptan Singh SolankiProf. Mohammad MiyanProf. Ram ShindeProf. Sanjay JhinganProf. Ved PrakashProf. Vijay K. ChaudharyProfessor of Head Department of BiochemistryPSupsu chairmans listpsu ntpcPSU of indiapsu updatePublic Grievances & PensionsPublic Healthpublic relation officers of PSUpublic sector undertakings of indiapulse poliopunab national bankPune DGAFMS Lt. Gen BK. ChopraPunjab National BankQuarterdeck bookQUARTERLY FINANCIAL RESULTS OF NATIONALISED BANKS OF INDIAR.K. MathurR.K. Tyagi former hal chairmanR.S. SharmaR.V. College of EngineeringRaahgiri Day for Persons with DisabilitiesRaahgiri Day for Persons with Disabilities in delhiRadha Mohan Singhrahul gandhiRail Bhavanrail bhawanRailway BoardRailway Board & Ex-officio Secretary to the Government of Indiarailway board membersrailway budgetrailway budget newsrailway ministryrailways newsRaipurRajasthanRajasthan Directoraterajasthan government newsrajasthan Suratgarh Military StationRajeev KherRajendra RathoreRajesh Agarwalrajiv gandhiRajiv Pratap RudyRajive Kumarrajnath singhRaksha Mantri Padakram naresh yadavram vilas paswanRamakrishna MissionRan of KachchRao Inderjit SinghRaosaheb Dadarao DanveRashtrapati Bhavanrashtrapati bhavan newsrationalravi shankar prasadravindra singhRBIRedesigned Websites of the Ministry of PowerRegulationsrenowned scientists of indiaREPUBLIC DAYRepublic day newsrepublic day of indiarepublic day tableau of the Ministry of Indian RailwaysRepublic of South AfricaREPUTED FASHION DESIGNERS IN INDIAreserve bank of indiaResource centerreutersRICHARD RAHUL VERMARiver Development and Ganga RejuvenationRoad Safety and Safe Mobility InitiativesROAD SAFETY WEEKROBERT VADRArpfrs chief mohan bhagwat controversial statement on Mother teresarss chiefruling powerRural and Maritime DevelopmentRural DevelopmentS. Iswaransacred bodhi plantSadhvi PrachiSalma Ansarisalman khansamacharnewssamadhi of mahatma gandhisamajwadi partsamajwadi partysamchar4mediaSankranti MilanSANTANU SAIKIAsantosh kumar gangwarSarbananda Sonowalsarkarisarkari babussarkari babus of indiasarkari bodiessarkari bodies of indiasarkari jobsarkari naukrisarkari newssarkari officialssarkari phonesarkari phone directorysarkari phone numberssarkari resultsarkari websitessarkarimirror.comsarkaritelSaurabh Chandrasaurabh chandra petroleum secretarySBIscientists of indiascope directorySCOPE HR Summit 2015scope hr summit newsscope newsscope telephone directoysebiSecond Session of the UNESCAP Working Group on Asian and Pacific Decade for Persons with DisabilitiesSecretary (Health)secretary amitabh kantsecretary ashok lavasasecretary indiasecretary of indiaSecretary of Ministry of Skill Development and EntrepreneurshipSecretary of Ministry of Skill Development and Entrepreneurship Sunil AroraSectorssecuritysenior Government representatives from 15 countries and 15 Civil Society Organizations in the Asia Pacific RegionSergey NaryshkinSesquicentennial function of Advocates' Association of Western IndiaSHAHRUKH KHANShaikh Khalid Bin Mohamed Al Khalifasharad pawarSharda UniversityShatrughan SinhaShivraj Singh ChouhanShri Anant Kumar SinghShri Arun Jaitley briefing the media about the deliberations of the first meeting of the Governing Council of NIITI Aayog chaired by the Prime MinisterShri Narendra ModiShri Raman SinghShri Rao Inderjit SinghShri Shingaji Thermal Power ProjectSIATSIDELINED BCCI CHIEFsigning of the agreements between Kamarajar Port Ltd. and Toyota Kirloskar motor Pvt. Ltd.Sikh RegimentsingaporeSir Ashutosh Mookerjeesir ganga ram hospitalSir Nicholas Patrick CarterSmall and Medium Enterprisessmriti iraniSneh Lata KumarSocial Justice & EmpowermentSocial MediaSocial securitySoil Health Cardsonia gandhisouth block of rashtrapati bhavanSpanish Defence Ministerspeaker of lok sabhasportssports news top sports newsSri Sri Ravi Shankarsrinagar newsSRKStage I of Shri Shingaji Thermal Power Project to the nation at KhandwastateSTATE BANK OF INDIAState Civil Servicesstate government newsstate government of indiastate governments of indiaStatesStatisticsStatus of Tigers in India 2014stiture Parade of Railway Protection Forcestock exchange of indiaSTYLIST AAMER ZAKIRSudarshan Bhagatsudhir bhargavasunil arorasupreme court of indiaSupreme Head of the Universal Syrian Orthodox ChurchSuratgarh Military StationSuratgarh Military Station in rajasthanSuresh Prabhakar PrabhuSuresh Prabhakar Prabhu launching a ‘Customer Complaint Web Portal and Mobile Application’sushma swarajswachh bharatSwami Shantatmanandaswine flu in Telanganasymbiosissymbiosis universitysymbiosis university puneSymposium on International Automotive TechnologyT. R. ZeliangT. Suvarna Rajutableau of cpwd republic dayTableaux ArtistesTableaux Artistes republic day parade 2015Takehiko NakaoTARUN TEJPALtaxTechnologyTechnoogytehelkaTELANGANA NEWSTelecom Servicestelegram sent by USA to the Indian Constituent Assembly in 1946telephone directory of governmenttelephone directory of government of indiatelephone directory of government officials of indiatex trends fairtex trends fair 2015Thaawar Chand GehlotThe Ambassador of Poland to IndiaThe Ambassador of the Republic of KoreaThe Ambassador-designate of United States of Americathe Calcutta High Court Chief Justicethe Central Adoption Resource Authoritythe Central Board of Excise and CustomsThe Chairmanthe Chairman of State Dumathe Chief Advisor to President of Islamic Republic of Iran and Secretary of Council for Free TradeThe Chief Economic AdviserThe Chief Election CommissionerThe Chief Minister of Biharthe Chief Minister of ChhattisgarhThe Chief Minister of DelhiThe Chief Minister of GujaratThe Chief Minister of HaryanaThe Chief Minister of Himachal Pradeshthe Chief Minister of Madhya PradeshThe Chief Minister of MaharashtraThe Chief Minister of ManipurThe Chief Minister of NagalandThe Chief Minister of PuducherryThe Chief Minister of RajasthanThe Chief Minister of TripuraThe Chief Minister of Uttar PradeshThe Chief of Army Staffthe Chief of Gen. Staffthe Chief of Naval Staffthe Commerce MinisterThe Commerce SecretaryThe Defence SecretaryThe DG NCCThe Director General AADthe Director General Coast GuardThe Director of the International Department of the Central Committee of the Communist Party of Chinathe election commissionerthe ENDOLAP 2014- Third Biennial International Conference and Advanced Live Laparoscopic WorkshopThe Finance Minister of Republic of Turkeythe Foreign Minister of BahrainThe former Chief Minister of J & KThe former Director of Indian Institute of ScienceThe former PresidentThe former President of MaldivesThe French Defence Ministerthe General & Census CommissionerThe Global CEOThe Governor of GoaThe Governor of Gujaratthe Governor of Haryanathe Governor of Jammu and Kashmirthe Governor of KarnatakaThe Governor of Madhya Pradeshthe Governor of West Bengalthe Health Ministerthe highest gallantry award Ashok ChakraThe Indian Boxerthe Indian Constituent Assemblythe Indian Machine Tool Manufacturer’s Associationthe International Mother Language DayThe Jr. Commanderthe Krantiguru Shyamji Krishna Verma Kachchh Universitythe launch of the National Deworming initiativeThe Lt. Governor of Andaman & Nicobar Islandsthe Minister for Agriculturethe Minister for Minority Affairs of Maharashtrathe Minister of CultureThe Minister of Defence and General of Army of Russia Sergey K. Shoyguthe Minister of EducationThe Minister of Foreign Affairs of JapanThe Minister of Health and Medical Services of Fijithe Minister of Industry and Tradethe Minister of Industry and Trade Czech Republic Jan MladekThe Minister of International Relations and CooperationThe Minister of Labour of CanadaThe Minister of State (Independent Charge) for Powerthe Minister of State for Chemicals & FertilizersThe Minister of State for Commerce & IndustryThe Minister of State for Consumer AffairsThe Minister of State for Culture (Independent Charge)The Minister of State for FinanceThe Minister of State for Heavy Industries & Public EnterprisesThe Minister of State for Home (Rural)The Minister of State for Home Affairsthe Minister of State for Human Resource DevelopmentThe Minister of State for Information & Broadcastingthe Minister of State for Labour and EmploymentThe Minister of State for Labour and Employment (Independent Charge)The Minister of State for Micro Small & Medium EnterprisesThe Minister of State for Minority Affairs and Parliamentary AffairsThe Minister of State for Petroleum and Natural GasThe Minister of State for Petroleum and Natural Gas (Independent Charge)The Minister of State for Planning (Independent Charge) and DefenceThe Minister of State for Railwaysthe Minister of State for Road Transport & Highways and ShippingThe Minister of State for Rural DevelopmentThe Minister of State for Science and Technology and Earth ScienceThe Minister of State for Skill Development & Entrepreneurship and parliamentary affairsthe Minister of State for Social Justice & Empowermentthe Minister of State for Statistics and Programme Implementation (I/C)The Minister of State for Urban Developmentthe National Deworming initiativethe National Librarythe National Science Day Lecture on “Science for Nation Buildingthe North Eastern Region MSMEs Conclave 2015The Parliamentary State SecretaryThe Peranakan World - Cross Cultural Art from Singapore and the Malacca Straitsthe presentation of Standards to 21 SQN & 116 HU of Indian Air ForceThe President Asian Development BankThe President of the Association of Biotechnology Led EnterprisesThe President of the Democratic Socialist Republic of Sri Lankathe President of the Republic of SingaporeThe Prime Minister of Macedoniathe Railway Budget 2015-16the Raksha Mantri’s Trophythe Second Minister for Trade & Industry of SingaporeThe Secretarythe Secretary (BM)The Secretary Ministry of Culture Ravindra SinghThe Secretary Ministry of TourismThe Secretary Ministry of Tribal Affairsthe Secretary of Delhi Ramakrishna MissionThe Spanish Defence Ministerthe State Level Khadi Gramodyog Exhibitionthe State Level Khadi Gramodyog Exhibition in guwahatiThe tableau of GoaThe tableau of Goa on rajpathThe tableau of Goa on rajpath on republic dayThe tableau of Indian NavyThe tableau of KarnatakaThe tableau of Maharashtrathe tableau of ministry of railwaysThe tableau of the Department of Financial ServicesThe tableau of the Department of Financial Services at republic dayThe tableau of the Ministry of Indian RailwaysThe tableau of the Ministry of Indian Railways on rajpathThe Tennis PlayersThe UGC ChairmanThe Union Minister for AgricultureThe Union Minister for Agriculture senior officials of ICARThe Union Minister for Chemicals and FertilizersThe Union Minister for Civil AviationThe Union Minister for Communications & Information TechnologyThe Union Minister for Defencethe Union Minister for External Affairs and Overseas Indian Affairsthe Union Minister for FinanceThe Union Minister for Health & Family WelfareThe Union Minister for Heavy Industries and Public EnterprisesThe Union Minister for Human Resource DevelopmentThe Union Minister for Law & JusticeThe Union Minister for MicroThe Union Minister for Minority AffairsThe Union Minister for RailwaysThe Union Minister for Road Transport & Highways and ShippingThe Union Minister for Rural DevelopmentThe Union Minister for Social Justice and EmpowermentThe Union Minister for Tribal AffairsThe Union Minister for Urban DevelopmentThe Union Minister for Water ResourcesThe Union Minister for Women and Child DevelopmentThe US PresidentThe Vice Chairmanthe Vice Chancellor of Maulana Azad National Urdu University (MANUU)the Vice President of the Asian Development Bankthe Voters’ Day Pledge at Kamla Nehru Collegethinkedu conclaveThird Biennial International Conference and Advanced Live Laparoscopic WorkshopThiruvalluvar Daytimes of indiatimes of india epaperTofail Ahmedtokyo newsTomasz Lukaszuktop 10 news websites of indiatop 10 websites of indiatop banks of indiatop bureaucracy websitestop bureaucrats of indiatop defence newstop defence news websites of indiatop educational institutestop english news websitesTOP FASHION NEWS OF INDIAtop global newstop governance websitestop government newstop government news websitestop government news websites of indiatop indian political newstop indian political news websitestop international newstop news of indiatop news storiestop news websitestop news websites of indiatop political newstop political news in indiaTOP POLITICAL NEWS WEBSITEStop political sitestop political web sitestop political websitestop psu newstop ten news websites in the worldtop ten news websites of asiatop ten news websites of indiatop ten websites of indiaTourism (Independent Charge) and Civil AviationTourism and Marketing of MaharashtraToyota Kirloskar motor Pvt. Ltd.Trade &transportationtribal food festivalTshering TobgayTughlakabadtwo-day National Thematic Workshop on the ‘Best Practices for Women and Child Development’UdyanotsavUdyanotsav of mughal gardenUKuk defence newsUNUN Genral SecretaryUNAUDITED FINANCIAL RESULTS OF NATIONALISED BANKS OF INDIAUNDERGROUND RESERVOIRS OF DELHI JAL BOARDUNESCAPUnileverUnion Home Ministerunion minister for raiwaysUnion Minister for Road Transport & Highways and Shippingunited kingdom defence newsunited nationsunited nations general secretaryUniversity of Delhiuniversity of lucknowuniversity of lucknow convocationUPUP CMup cm akhilesh yadavUPA MINISTER KRISHNA TIRATHupdated government newsupdated newsUpendra KushwahaUrban Auxiliary Nurse Midwifeus ambassador to indiaus president arack Obama inspecting the Guard of Honourus president barack obamaus president during india visitUS Secretary of CommerceUS Secretary of StateUTUtilitiesUTsUwe BackmeyerVajubhai RudabhaiValedictory Session of the Pravasi Bharatiya Divas 2015VARDAAN DOCUMNTARY FILMvarun dhawanVasundhara Raje Scindiavibrant gujaratVibrant Gujarat Global SummitVice Admiral Anurag G. Thapliyalview of the illuminated Rashtrapati BhavanVijay SamplaVinayak Shah Marge & Dorabi Tata MargeVirbhadra SinghVisaVision 4G-India’s next Telecom Revolutionvisitor’s book at the Amar Jawan Jyotivoter id applicationvoter id cardvoters card list of indiaVOTERS DAYWang Jiaruiwater newsWencai ZhangWest Zone Cultural CentreWest Zone Cultural Centre Udaipurwhats happening in indiaWHITE DESERTwho is delhi chief ministerWHO IS THE CURRENT MD OF PUNJAB NATIONAL BANKWHO IS THE EXECUTIVE DIRECTOR OF PNBwife of vice president of indiaWildlife Crime Monitoring SystemsWinners of the National Bravery Awards-2014Wirelessworkshop on ‘Performance Evaluation and Management of State Owned Enterprisesworkshop on National Aviation Universityworkshop on Streamlining Government CommunicationWorkshopsworld best political newsworld best political news websiteworld best political news websitesworld breaking newsworld embassies indiaworld government newsWorld Leprosy Dayworld newsWorld Toilet Summit 2015Y.S. Chowdaryyair shamirYakovlevs - a four aircraft display team from UKYami GautamYelahankazeenewsZoological Survey of Indiazsi
The President, Shri Pranab Mukherjee addressing at the 8th National Biennial Awards for..
State

The President, Shri Pranab Mukherjee addressing at the 8th National Biennial Awards for..

sarkarimirror March 7, 2015

The President, Shri Pranab Mukherjee addressing at the 8th National Biennial Awards for Grassroots Innovations and outstanding Traditional Knowledge, at Rashtrapati Bhavan, in New Delhi on March 07, 2015. The … Read More

. The Minister of State for Road Transport & Highways and Shipping P. Radhakrishnan‘National conference on Strengthening of Cooperative - Education and Training system“Beti Bachao14th World Toilet Summit 2015150th birth anniversary celebrations of Sir Ashutosh Mookerjee15th International Seminar on “Counter IED Strategy15th International Seminar on “Counter IED Strategy by nsg19th convocation Ceremony of NIMHANS2013-2022 in New Delhi2015. The Vice Chairmen of NITI Aayog20th Meeting of the Central Zonal Council21st International Conference & Exhibition on Terrestrial and Satellite Broadcasting24th Admiral R.D. Katari Memorial lecture29th Arunachal Statehood Day29th Arunachal Statehood Day function29th meeting of the Central Consumer Protection Council400kV GIS sub-station44th Battalion Rashtriya Rifles4th India International Potato Expo-201553rd Annual Session of Cement Manufacturers’ Association66th republic day celebration of india66th Republic Day of india67th army day7th Vibrant Gujarat Global Summit 20158th National Biennial Awards for Grassroots Innovations and outstanding Traditional KnowledgeA. SethumadhavanA. Sethumadhavan chairman of national book trust of indiaA.K. MitalaajtakAAM AADMI PARTYAAMER ZAKIRAAMER ZAKIR INTERVIEW IN SARKARIMIRRORAAMER ZAKIR INTERVIEW WITH TARUN SHARMAAAMER ZAKIR INTERVIEWSAAMIR KHANaapAAP LEADER ASHUTOSHAcute Encephalitis SyndromeAdditional Member (Commercial) Railway BoardAdditional Secretary (Centre-State)Addl Secy. (Health)Adi Sankara’sAdi Sankara’s lifeAdmiral Harry HarrisAdmiral R.D. KatariAdmiral R.K. DhowanAdvocates' Association of Western IndiaAero India-2015Aero India-2015 Air ShowAESafr of psuAGMagm of psuagricukture newsagricultureAgriculture Minister of Israelagriculture newsaiccaicc chiefAir Chief Marshal Arup RahaAir Marshal J.S. Klerairline operators in indiaairlines in indiaAjay ShuklaAkbar Torkanakhilesh yadavAll India Citizens’ Alliance for Progress & DevelopmentALL INDIA CRIME NEWSAll India Federation of the Deaf’All India Federation of the Deaf’ PresidentAll India Federation of the Deaf’ President Kum. Surrender SainiAll India Shwetamber Sthanakvasi Jain ConferenceAll India Shwetamber Sthanakvasi Jain Conference presidentAll India Shwetamber Sthanakvasi Jain Conference spiritual mahakubh indoreAll India Shwetamber Sthanakvasi Jain Conference spiritual mahakumbhAmar Jawan JyotiAmbassador of China to Indiaambassadorsambassadors of indiaambassadors of various contries in indiaambassadors to indiaambassadors to india from across the globeamitabh kantAmitabh Kant secretaryanandiben patelanant GeeteAnanthkumarAnil SwarupANMAnti LeprosyAnti Leprosy dayAnti Leprosy FortnightAnti Leprosy weekApplicationsarack Obama inspecting the Guard of Honour during india visitarmuy daiAROON PURIEarun jaitleyArunachal Statehood DayArundhati Bhattacharyaarvind kejiwalarvind kejriwal delhi chief ministerArvind Panagariyaashok chakraAshok Gajapathi Raju PusapatiAshok LavasaASHUTOSHasia newsasian development bankASSOCHAMAssociate professor Department of biochemistryAssociation of Chambers of Commerce& Industries in IndiaAt Home` reception of US President Barack obama in new delhi oon 66th india republic dayat the inauguration of the DGNCC Republic Day Camp 2015at the World Book Fairat the World Book Fair-2015AUDITED FINANCIAL RESULTS OF NATIONALISED BANKS OF INDIAaustralian senatorautonomous bodies of indiaaviation newsB S BASSIB.P. SharmaBabul Supriyobabusbabus of indiaBAE Systemsbahrain newsbahujan samaj partyBalmerLawrie& Co. LtdBan Ki-moonBand performing at the Beating the Retreat CeremonyBand performing at the Beating the Retreat Ceremony at rashtrapati bhavanBandaru DattatreyaBangaloreBank MitrBANKSbanks in indiaBarack Obamabarack obama india visit on republic dayBarack Obama paying floral tributes at the Samadhi of Mahatma Gandhibaramati newsbasic needsbbcBC AGENTSBCCI CHIEFbeating retreatbenefits the societyBengal Global Business SummitBES EXPO-2015BEST BANKS OF INDIAbest diplomacy newsbest diplomacy websitesBEST DOCTORS OF SIR GANGA RAM HOSPITALbest entertainment newsbest news of indiabest news websitesbest political sitesbest political websitesbest political websites of indiabest Road Safety PracticesBeti hai to kal haiBeti Padhao logoBHARAT ELECTRONICS LTD.Bharat Rang MahotsavBharat Rang Mahotsav organised by National school of dramaBhuj newsBhupendrasinh M. Chudasamabhutan newsBicentenary Celebrations of Gorkha Riflesbimal julkaBimal Julka inaugurating the Display of Publications Division’s books at the World Book Fair-2015Birth Anniversary Celebration of Swami VivekanandbjpBJP PRESIDENTboard members of indian railwaysbodhi plantbollywood newsBollywood starsbombay high court museum officialsBook of the Institute of Indian LanguagesBook of the Institute of Indian Languages Mysorebook on Adi Sankara’s lifebook on Adi Sankara’s life and teachinsbook Quarterdeckbook release India–2015 Reference Annualbooks by northern railwaysbooks published by northern railwaysborder haatborder hatt at srinagarBorder Security ForceBranding ideasbreaking newsbreaking news of indiaBRICS International Youth Forum 2015britains BAE Systems for Indian Air ForceBSEbse quotesbspbudget session of parliament of india 2015bureaucracybureaucracy todaybureaucracy today in indiabureaucratsbureaucrats in indian politicsBUREAUCRATS NEWSbureaucrats of indiaBusinessbusiness entertainment news in ENGLISH about india local news onlinebusinessworldC.K. Mishracabinet ministers of indiaCadet Sergeant Shubham Bairagicadets from Jammu & KashmircaraCENSER BOARD CHIEFCENSOR BOARD OF INDIACentenary Celebrations of by Zoological Survey of IndiaCentenary Celebrations of ZSIcentral government directorycentral government newscentral government of indiaCENTRAL RAILSIDE WAREHOUSING CORPORATION LTD.CEO DELHI JAL BOARDCEO DJBceo helpage indiaCEO OF DELHI JAL BOARDceo poscoCEO-Designate Allianz Group of GermanyChairman and Managing Director of National Research Development Corporationchairman of hindustan aeronauticals ltdchairman of national book trustchairman of psuchairman of visitbritainCHAIRMAN SPEECH OF GOVERNMENT BANKS OF INDIACHAIRMAN SPEECHES OF BANKS IN INDIAchairmans of psuCHAIRPERSON SBICHANDIGARH NEWSChaudhary Birender Singhchennai newsChhattisgarhCHIEF ELECTION COMMISIIONERchief justice of indiachief manager of psuChief Minister of GujaratChief Minister of HaryanaChief Minister of KeralaChief Minister of Madhya Pradeshchief ministers of indiachief ministers of statesChief of Army Staffchief of the air staff indiachina newsCHRISTIAN COMMUNITY NEWS IN INDIAChristopher Rodriguezcitation for the Best Service Hospital to Command Hospital (SC)Citizen Journalistcivil aviation minister of indiacivil aviation newsclosing ceremony of the National Tribal Festival- 2015 VANAJcm akhilesh yadavcm delhi inaugrates dwarka water treatment plantCMDcmd air indiacmd bhelcmd bsnlcmd delhi tourismcmd ficcicmd gailcmd hudcocmd irconcmd irctccmd licCMD MTNLcmd nalcocmd national insurancecmd nhpcCMD NRDCcmd ntpccmd obcCMD of Biocon Limitedcmd of indian psucmd of psucmd of psu of indiacmd ongccmd oriental bankcmd pnbCMD POSCO INDIAcmd powerfinancecmd powergridCMD Punjab & Sind Bankcmd railtelcmd reccmd ritescmd sailcmd scicmd sidbicnbcCNN IBN EDITOR ASHUTOSHCoal and New & Renewable EnergyCoal and New and Renewable EnergyCoal and New and Renewable Energy the Minister of State (Independent Charge) for PowerCoal and NRECol. Rajyavardhan SinghCol. Rajyavardhan Singh RathorecolumnCOMEDIAN KAPIL SHARMAComedy Nights With Kapil.CommerceCommunicationsComputerconference on pahalcongresscongress partyConnectivityCONSTABLE AJMERSINGHConstitutionconsulate of indiaConsultative Workshop on Urban GovernanceContest for PMO Mobile App developmentController General of Defence AccountsCorporate Affairs and Information & BroadcastingCosmology and Astrophysics Research Group Centre for Theoretical Physicscpwdcpwd newscpwd tableau at rajpath on republic dayCRIME NEWScurremnt newcurrent affairscurrent affirscurrent chairman of hindustan aeronauticals ltdcurrent cmd of ntpccurrent newscurrent speaker of lok sabhaCzech RepublicD.V. Sadanandadare devil stunts of motorbike riders of Border Security ForceDASDatacentersdefence newsdefence personnels of indiaDefence Researchdefence websites of indiadefenseDelhi Administration Subordinate Service Cadredelhi assemblydelhi assembly elction newsdelhi assembly elections 2015delhi assembly elections latest newsDELHI CHIEF MINISTERdelhi crime newsdelhi deputy chief ministerdelhi economic surveydelhi governmentdelhi government newsdelhi jal boarddelhi jal board ceoDELHI JAL BOARD CHAIRPERSONDELHI JAL BOARD DWARKA WATER TREATMENT PLANTDELHI JAL BOARD HEAD OFFICEdelhi jal board newsDELHI NEWSdelhi policedelhi police commissionerDELHI POLICE EAST DELHIdelhi police head quarterdelhi police head quartersDELHI POLICE SPECIAL STAFFDELHI POLLSDELHI POLLS DATEDELHI TRANSPORT ROAD SAFETY WEEKDELHI TRASPORT NEWSDELHI WATER SUPPLIERSdeli police newsDepartment of Atomic EnergyDepartment of Electronics and Information TechnologyDepartment of Empowerment of Persons with DisabilitiesDepartment of Financial ServicesDepartment of Industrial Policy and PromotionDepartment of Spacedeputy chief minister of delhiDeputy Prime Minister of PolandDevelopment and Technology CooperationDevendra FadnavisDGDG (Inspection & Safety)dg J. N. Chakarvatidg nccDG NCC Republic Day Camp 2015dg nsgDGNCC Republic Day Camp 2015Dharmendra Pradhandiplomacy websitesdiplomacy websites in indiaDirector GeneralDirector General (M&C)directory of central governmentdirectory of embassies consulates in indiadirectory of government of india officialDisaster ManagementDiscussion boardDistrictsDivya Singh Deo GajapatiDJB introduces Online Complaint Registration and Status Check Facility for its consumersDoordarshandr m ravikantDr. A.P.J. Abdul KalamDr. Amita GuptaDr. Arup Roy ChoudhuryDr. Arvind SubramanianDr. C. ChandramouliDr. H. PandaDr. Hanumanthu PurushothamDr. Jitendra SinghDr. K.K. PaulDr. Kellie LeitchDr. Lalit K. PanwarDr. Mahesh SharmaDr. Najma A. HeptullaDr. P. BalaramDr. P. C. KokilaDr. Rajendra Prasad Sarvodaya VidyalayaDr. Rakesh KumarDr. Raman SinghDr. Syed Nasim Ahmad ZaidiDr. Tony Tan Keng YamDr.RAM .S.SANGAPUREDrinking Water and Sanitatione governanceE-book of Ministry of EnvironmentEconomic Growtheconomic surveysEconomicsED GAURI SHANKAREducationeducational institutes in greater noidaeIndiaEknath Khadseelection commisiionELECTION COMMISSIONELECTION COMMISSION OF INDIAelections model code of conductElectoral Roll databaseembassies abroad indiaembassies in delhiembassies in indiaembassies of indiaENGLISH newsENTERTAINMENT NEWSEnviornmentEnvironmenterickshawserickshaws association in delhierickshaws in delhiesic chennaiethiraj college for womeneurope newseuropre newsEXCHANGE4MEDIAExecutive Director PUNJAB NATIONAL BANKExternal Affairs and Overseas Indian Affairsfarmers newsFarmers RallyFarmers Rally at baramatiFASHION DESIGNER AAMER ZAKIRfashion designers in indiafather of nation mahatma gandhiFederal Assembly of Russian FederationFICCIFijiFINANCEfinance newsfinancial institutes in indiaFINANCIAL RESULTS OF BANKSFirst Lady Michelle ObamaFirst Visitors Award-2015 for the Research 2015flying Russian origin Yak aircraftFood and Public Distributionforeign ambassadors in indiaforeign embassies and consulates in indiaForest and Climate ChangeForests and Climate ChangeFORMER JOURNALIST SANTANU SAIKIAfoundation day of NCPCRFoundation Stone laying Ceremony of the Centre of Excellence for Vegetable Development in BaramatiFoundation Stone laying Ceremony of the Centre of Excellence for Vegetable Development in Baramati by prime minister of indiaFrench Defence Ministerfull dress rehearsal for the Republic Day Parade-2015Fumio KishidaG.M. Siddeshwaragallantry award Ashok ChakraGandhigandhi familyGandhi Peace FoundationGandhi SmritiGANDHINAGARGANDHINAGAR NEWSgauri shankarGee Woong SungGeneral (Retd.) V.K. SinghGeneral Budget 2015-16General Dalbir SinghGENERAL KNOWLEDGEGeneral Managers PR of psuGeneral Zhang YouxiaGermanygermany newsgfilesindiagiriraj singhGISGLOBAL NEWSglobal news websitesgm of psugoernment of jaipurGoIgoi officialsGolden Jubilee Celebrations of R.V. College of Engineeringgorkha riflesgovernancegovernance newsgovernance nowGoverning Council of NIITI Aayoggovernment contact directorygovernment contact listgovernment contactsgovernment directorygovernment jobsGOVERNMENT JOBS IN INDIAGovernment Law CollegeGovernment Law College Mumbaigovernment newsgovernment news indiagovernment news of indiaGOVERNMENT OF DELHI NEWSGOVERNMENT OF GUJARATgovernment of indiaGovernment of india contact numbersgovernment of india newsgovernment of india news todaygovernment of india official contactgovernment of india official contact detailsgovernment of india official contact numbersgovernment of india official contactsGOVERNMENT OF INDIA OFFICIALSgovernment of india officials newsgovernment of india telephone directorygovernment of india websitesGovernment of Madhya PradeshGOVERNMENT OF NCT OF DELHIGovernment of RajasthanGovernment of the People's Republic of Bangladeshgovernment phone directorygovernment psu of indiaGOVERNMENT PSU OF INDIA NEWSgovernment telephonegovernment telephone directorygovernment telephone numbersgovernment tendersgovernnanceGovernor of UttarakhandGovt IssuesGuard of Honour during the presentation of Standards to 21 SQN & 116 HU of Indian Air Force in Jodhpurgujaratgujarat newsGujarati Association malaysiaGujarati AssociationsGujarati translation of ThirukkuralH.S. BramhaHALhal bangalorehamid ansarihamid ansari office addressHansraj Gangaram Ahirhappening news of indiaHaribhai Parathibhai ChaudharyHARISHANKAR BRAHMAHAWK MK 132 simulatorhe Minister of State for Development of North Eastern RegionHead of General Armament Department of the PLA and the member of CMChead quarters of delhi policeheadlines in cricketheadlinestodayHeads of Mission Conferenceheads of psu of indiahealth issueshealth newsHealth Sustainabilityhelpage indiaHelpline for Drug De-AddictionheritageHeritage City Development and Augmentation Yojanahigh commission in delhihigh commission in new delhihighlights of union budgetHIGHLIGHTS OF UNION BUDGET 2015Hight CourtHind Kusht Nivaran Sanghhindustan aeronauticals ltdhindustan aeronauticals ltd chairmanHindustan Aeronautics LimitedHindustan Aeronautics Ltdhindustan timeshindustan times epaperhome minister of indiahome secretary L.C. Goyal.who is the home secretary of indiahorticulturehorticulture newshorticulture updtaeshospitalsHotel TridentHousing and Urban Poverty AlleviationHousing and Urban Poverty Alleviation and Parliamentary AffairsHRIDAYHTT-40 trainerhuco newsHUDCOhudco bhawan at new delhihudco bhawan at salt lakeHUDCO CMDHUDCO NEWShudco office in new delhiHuman RightsHYDERABAD NEWSIAASiafIAF Republic Day Parade 2015 marching contingentiariIASias dr m ravikantIAS HARISHANKAR BRAHMAIAS OFFICERSias officers of indiaias preparationsIBAIBA BANKING TECHNOLOGY AWARDibn7ibn7 nwsibnliveIESIFoSifsiisimphal newsIMTEX and Tooltech-2015in New Delhiin New Delhi on February 08inadian army newsinaugration of delhi jal board water treatment plant by arvind kejriwalinaugration of India Water Week 2015inaugration of Multimodal Manufacturing Project of GEinaugration of Multimodal Manufacturing Project of GE by narendra modiinaugural ceremony of the 63rd All India Police Wrestling Cluster 2014-15inaugural ceremony of the 63rd All India Police Wrestling Cluster 2014-15 organised by itbpinaugural session of the 14th World Toilet Summit 2015inauguration of the 7th Vibrant Gujarat Global Summit 2015inauguration of the AIR Chennai’s broadcast of Vividh Bharati on FM channelinauguration of the National Meet on Adoptioninauguration of the New Railway Line between Hazaribag and Kodarma in Jharkhandinauguration of the Oil & Gas Conservation Fortnight of PCRA 2015inauguration of the Public Art Innovation on sustainability “Ganga Waterfront”INCOME TAXincome tax commissionerincome tax departmentincome tax department of indiaincredible indiaindiaindia 7th Agricultural Summitindia air chiefindia best bureaucracy websiteindia best english news websitesindia best news websitesindia best political newsindia best political news websiteIndia Breaking Newsindia bureaucratsINDIA CENSOR BOARDindia chief justiceINDIA CHRISTIAN COMMUNITY NEWSindia civil aviation ministerindia civil aviation newsindia curent affairsindia current affairindia current affairsindia defence newsindia election newsindia fashion newsIndia Gateindia general newsindia home ministerindia horticulture newsindia ias officersindia international newsIndia International Potato ExpoIndia International Potato Expo-2015india khadi industriesindia latest newsindia list of ias officersindia list of ips officersindia nationalised banksindia netasindia newsindia news websitesindia parliament houseindia parliamentariansindia parliamnet newsindia police commissionersindia political newsINDIA POLITICAL PARTIESindia prominent scientistsindia railways tableau at 66th republic dayINDIA REPUBLIC DAYindia republic day beating retreatindia republic day newsindia resultsgovernment jobsindia sarkari babusindia sarkari newsindia Sikh Regimentindia space research organisationindia state governmentsindia todayindia top banksindia top bureaucratsindia top government news websitesindia top n ewsindia top newsindia top news websitesindia top political sitesindia top psu newsINDIA TOP TEN BANKSindia top ten news websitesindia updated newsindia vice presidentindia votersIndia Water Week 2015India-US Strategic DialogueIndia–2015 Reference AnnualIndia–2015 Reference Annual book releaseIndia’s new visa shift and synergies between Britain and Indiaindia’s top 10 bureaucratsINDIAN ADMINISTRATIVE SERVICESIndian Agricultural Research Instituteindian air forceindian air force newsindian ambassador to the united statesINDIAN AMBASSADORSindian armyindian babusINDIAN BANKING ASSOCIATIONINDIAN BUREAUCRACTSindian bureaucracyindian bureaucrats blogINDIAN BUREAUCRATS LISTIndian Coal Story – Prospects and Challengesindian defence newsindian diplomacyINDIAN DIPLOMATSindian diplomats contact numberindian diplomats newsIndian Economyindian embassyindian financial instituesindian governanceindian governance top news websitesindian governmentindian government contactindian government contact detailsindian government contact numbersindian government dirctoryindian government home secretaryindian government newsindian government official websiteindian government phone directoryindian government websitesindian ias officersindian militaryindian military newsindian national congress partyINDIAN NAVRATNASindian ngoindian nri newsINDIAN POLICE SERVICESIndian political newsindian politicsindian politics newsINDIAN PREMIER LEAGUEIndian PSUindian psu headsindian railway boardindian railway board membersindian railway budgetindian railway budget 2015indian railwaysindian railways newsindian railways officialsindian states newsindiatodayindira gandhiIndo Tibetan Border Police ForceINDO-US RELATIONSHIPIndustrial and SEZsIndustriesInformation TechnologyinfrastructureInia Batikoto SeruiratuInstitution of Permanent Way EngineersintegratedINTELECT-2015 & UPTO 11kv exhibitionINTELECT-2015 & UPTO 11kv international exhibitionIntermediate Jet TrainerInternational Customs Day 2015international government newsinternational Gujarati Associationsinternational newsinternational news websitesInteroperableINTERVIEWS OF TOP FASHION DESIGNERS OF INDIAInveInvestiture Ceremony 2015IPLIPSipweipwe indiairsISROisro chiefITit minister of indiait ministryitbpitbp newsITSJ. N. ChakarvatiJ. N. Chakarvati dgJagat Prakash NaddaJaguar Darin-IIIjaipur newsJamia Milia IslamiaJammu and Kashmir newsJammu UniversityJan MladekJanusz Piechocinskijapan newsJapanese EncephalitisJayant SinhaJayanthi SirisenaJEJean Yves Le DrianJHARKHAND NEWSJim Yong KimJitan Ram Manjhijohn kerryJoint SecretaryJoint Workshop on Skill Development and EntrepreneurshipJoint Workshop on Skill Development and Entrepreneurship in new delhiJone UsamteJoon-Gyu LeeJS (RMNCH+A)Jual Oramjual ramK BISWALK U THANKACHANK. RadhakrishnanK.V. Brahmaji RaoKailash Mansarovar Yatra 2015Kailash SatyarthiKalraj MishraKamarajar Port Ltd.Kapil SharmaKAPIL SHARMA COMEDIANKarnataka & GoaKeshari Nath TripathiKhadikhadi gramudyogkhadi industry in indiakhadi newsKiran Kumar Alur SeelinKiran Mazumdar ShawKiren RijijuKMY website & bilingual Interactive Voice Response System (IVRS)kolkata newsKolkata.Krishan PalKrishna TirathKRISHNA TIRATH DALIT LEADERKum. Surrender SainiKwon Oh-JoonL.C. GoyalLALU YADAVlatest amabassadors of indialatest baramati newslatest bureaucrats newslatest bureaucrats of indialatest chairperson of delhi jal boardlatest china newsLATEST CRIME NEWSlatest defence newslatest delhi government newslatest delhi jal board newslatest europe newslatest fashion newslatest finance newslatest government newslatest high commisions in indialatest hudco chairmanLATEST HUDCO CMDlatest hudco newslatest ias officerslatest india newslatest indian railways newslatest internationla newslatest ips officerslatest itbp newslatest jharkhand newslatest military newslatest ncc newsLatest Newslatest news from indialatest news of government of madhya pradeshlatest news of indialatest ntpc newsLATEST PATNA NEWSlatest political newslatest political news indialatest political news of indialatest prime minister of indialatest psu newslatest railway budgetlatest rss newslatest water newslatest world newslatets crime newslatets enws of indialaunch of the “2015 – Year of Active Pharmaceutical Ingredientslaunch of the Venture Capital Fund for Scheduled CastesLawrence WongLe YuchengLEANDER PAESLEELA SAMSONLEELA SAMSON CENSER BOARD CHIEFLeprosy Seal CampaignLight Combat AircraftLight Combat HelicopterLight Utility Helicopterlisa singhlist of ambassadors in indialist of chief ministers of statelist of cmd of india psulist of diplomatic missions of indialist of indian bureaucratslist of top navratnasLord Ian LivingstonLov VermaLt Gen V.K. SaxenaLt. Gen. A. ChakravartyLt. Gen. Aniruddha ChakravartyLt. General (Retd.) Shri A.K. Singhlucknow newsm-Governmentmadhuri dikshitmadhya pradesh chief ministermadhya pradesh newsmadras high courtmadras high court newsMahabodhi templeMaharaja of Purimaharajas of jaipurmaharshtra mla’smahatma gandhimahatma gandhi statuemahatma gandhi statue at gandhinagarMaite Nkoana-MashabaneMaithripala SirisenaMajor Mukund VaradarajanMajor Mukund Varadarajan 44th Battalion Rashtriya RiflesMANAGING DIRECTOR CRWCManeka Sanjay GandhimangalyaanManik Sarkarmanipur newsmanish sisodiaManjula ChellurManohar Lal KhattarManohar ParrikarManoj SinhaMartina HingisMartina Hingis and Leander Paesmartyr's dayMARY KOMMary Tanmatdan mahotsavMathews Cherian ceoMathews Cherian ceo helpage indiaMathribhasha DiwasMathribhasha Diwas celebrationsMaumoon AbdulMCC Chamber of Commerce & IndustryMCC Chamber of Commerce & Industry kolkatamcdmcd commissionermcd newsmeeting of the Central Consumer Protection CouncilMehmetMember of Parliament.Member Trafficmembers of parliament of indiaMHAMilitarymilitary newsminister giriraj singhMinister of State for Culture (Independent Charge)Minister of State for Trade & Investment of UKMinister of State with Independent Charge for Powerministers indiaministers of indiaministries and departmentsministries contact numbersministries of govt. of indiaMINISTRIES OF INDIAministry for developmentMinistry of CoalMinistry of CultureMinistry of FinanceMinistry of Home AffairsMinistry of Information and Broadcastingministry of msmeministry of petroleumMinistry of Petroleum & Natural GasMinistry of PowerMinistry of ShippingMirage upgradeMLAmla’s of indiamodel code of conductmodel polling boothMODI LUNCH AT PARLIAMENT CANTEENMODI TAKING LUNCH AT PARLIAMENT CANTEEN NEWSmohan bhagwat latest newsMOHFWMOTHER TERESAmotorbike riders of Border Security ForceMOU BETWEEN BalmerLawrie& Co. Ltd & Controller General of Defence Accountsmou between Kamarajar Port Ltd. & Toyota Kirloskar motor PvtMr. H.H. Moran Mor Ignatius Aphrem IIMridaparikshak Lab (for Soil Analysis) at Indian Council of Agricultural ResearchMridula SinhaMrs. S. Ramsay editor of quarterdeckmsmemsme awardsmsme minister kalraj mishramsme minister of indiaMufti Mohammad SayeedMughal Gardens of Rashtrapati BhavanMukhtar Abbas NaqviMultimodal Manufacturing Project of GEMumbaiMUMBAI NEWSmumbai policemumbai political newsmunicipalities of various states of indiaMurli Deora ckowkMysoremysore newsN SRINIVISANN. RangaswamyN.N. VohraNarendra Modi having 'Walk the Talk' with the US PresidentNarendra Modi in ‘One on One’ Talks on the tea with the US PresidentNariman Point MumbaiNation-Wide inaugural ceremony of Value Education organised by Ramakrishna MissionNational Awards for the Best Electoral Practicesnational book trustnational book trust of indiaNational Bravery Award winnersNational Bravery Award winners 2014National Bravery Award-2015 winner childrenNational Bravery Award-2015 winner children with vice president of indiaNational Conference on Animal Taxonomy–Challenges and ProspectsNational Conference on Animal Taxonomy–Challenges and Prospects organised by Zoological Survey of IndiaNational Conference on Development & Export of SpicesNational Conference on Strengthening the Economy through Judicial Reformsnational congress partyNational Disaster Response ForceNational Meet on Adoptionnational school of dramanational security guardNational Skill Development Corporationnational stock exchangeNational Tiger Conservation AuthorityNational Voters’ DayNational youth Daynationalised banks of indianavratnasnavratnas listNCCncc cadetsncc dgncc newsncc rallyNCC Republic Day Parade CampNCC Republic Day Parade Camp 2015ncpncp partyncpcrndmcndrfndtvnetasnetas of indiaNetworkingNew DelhiNEW DELHI NEWSnew Member Mechanicalnewsnews about indianews about states of indianews of different states of indianews of indianews of psu’s of indiaNEWS ON WATER SUPPLIERS OF DELHInews online latest news in ENGLISHnews todayNews Updatenews website latest NEWS photos videos news breaking news in ENGLISHnews websitesNGO IN INDIANGOsNicola GruevskinimhansNirmala SitharamanNISGniti ayogNobel Peace LaureateNoida Shaheed Smarak.Nokianokia newsnorth block of rashtrapati bahavanNorth Eastern Region MSMEs Conclave 2015northern railwaysnorthern railways newsNRDCnrinsdnsense mumbainse quotesnsgNSS VolunteersNTPCntpc cmdNTPC K BISWALntpc ladies clubntpc ladies club newsntpc newsO.P. Kohliofficial directory of government of indiaOil & Gas Conservation FortnightOil & Gas Conservation Fortnight-2015oil psuOkram Ibobi SinghOliver-BaeteOm Prakash Dhankaromar abdullahOommen Chandyorganised by the eminent artist Manav GuptaP. RadhakrishnanP.C. Agarwal Secretary HKNSP.V. RajagopalPacific Fleet US NavyPanchayati RajparliamentParliament HouseParliament newsparliament of indiaparliament of india newsParliamentariansParliamentarypassportpassport applicationPATNA NEWSPaul PolmanPay CommisionPCSPedro Morenes EulatePenny PritzkerPeoplePersonnelPETROLEUM MINISTRYpgcilphone directoryphone number of indian govtphone numbers of government of indiaphone numbers of indian government employeesPinaka 214 MM Multiple Barrel Rocket Launcher SystemPiyush GoyalPlenary Session III of Youth Pravasi Bharatiya Divas 2015PMNRFPMO Mobile App developmentpnbPNB DOCUMENTARY FILMPNB DOCUMENTARY FILM VARDAANpnb ed gauri shankarPNB EXECUTIVE DIRECTORPNB PrernaPNB supported Hind Kusht Nivaran Sangh for leprosy eradicationpoland newsPOLICE COMMISSIONER B S BASSIpolice commissionerspolice commissioners listPoliciesPolicyPOLIO DROPSpolio in indiapoliticalpolitical newspolitical news of indiapolitical parties in indiapolitical sitespolitical websites of indiapoliticspolitics newsPopulationport blairport blair newsposcopower gridPower Grid Corporation of India Limitedpower persona of the year awardspower psupower psu newsPower Solutionspowerful bureaucrats of indiaPrakash MishraPravasi Bharatiya DivasPravasi Bharatiya Divas 2015Pravasi Bharatiya Samman Awardspremier banks of indiapresident assochampresident ficciPresident Gorkha Brigade and Colonel of the Regiment 5 Gorkha Riflespresident of india administering polio dropsPresident of World BankPresident's EstatePress Information Bureauprime minister national relief fundPrime Minister of Bhutanprime minister of indiaprime minister of polandPrime Minister's NCC RallyPrime Minister's Officeproducer Dinesh VijanProf. (Dr.) Ram Shankar KatheriaProf. Anjan Ananda SenProf. Kaptan Singh SolankiProf. Mohammad MiyanProf. Ram ShindeProf. Sanjay JhinganProf. Ved PrakashProf. Vijay K. ChaudharyProfessor of Head Department of BiochemistryPSupsu chairmans listpsu ntpcPSU of indiapsu updatePublic Grievances & PensionsPublic Healthpublic relation officers of PSUpublic sector undertakings of indiapulse poliopunab national bankPune DGAFMS Lt. Gen BK. ChopraPunjab National BankQuarterdeck bookQUARTERLY FINANCIAL RESULTS OF NATIONALISED BANKS OF INDIAR.K. MathurR.K. Tyagi former hal chairmanR.S. SharmaR.V. College of EngineeringRaahgiri Day for Persons with DisabilitiesRaahgiri Day for Persons with Disabilities in delhiRadha Mohan Singhrahul gandhiRail Bhavanrail bhawanRailway BoardRailway Board & Ex-officio Secretary to the Government of Indiarailway board membersrailway budgetrailway budget newsrailway ministryrailways newsRaipurRajasthanRajasthan Directoraterajasthan government newsrajasthan Suratgarh Military StationRajeev KherRajendra RathoreRajesh Agarwalrajiv gandhiRajiv Pratap RudyRajive Kumarrajnath singhRaksha Mantri Padakram naresh yadavram vilas paswanRamakrishna MissionRan of KachchRao Inderjit SinghRaosaheb Dadarao DanveRashtrapati Bhavanrashtrapati bhavan newsrationalravi shankar prasadravindra singhRBIRedesigned Websites of the Ministry of PowerRegulationsrenowned scientists of indiaREPUBLIC DAYRepublic day newsrepublic day of indiarepublic day tableau of the Ministry of Indian RailwaysRepublic of South AfricaREPUTED FASHION DESIGNERS IN INDIAreserve bank of indiaResource centerreutersRICHARD RAHUL VERMARiver Development and Ganga RejuvenationRoad Safety and Safe Mobility InitiativesROAD SAFETY WEEKROBERT VADRArpfrs chief mohan bhagwat controversial statement on Mother teresarss chiefruling powerRural and Maritime DevelopmentRural DevelopmentS. Iswaransacred bodhi plantSadhvi PrachiSalma Ansarisalman khansamacharnewssamadhi of mahatma gandhisamajwadi partsamajwadi partysamchar4mediaSankranti MilanSANTANU SAIKIAsantosh kumar gangwarSarbananda Sonowalsarkarisarkari babussarkari babus of indiasarkari bodiessarkari bodies of indiasarkari jobsarkari naukrisarkari newssarkari officialssarkari phonesarkari phone directorysarkari phone numberssarkari resultsarkari websitessarkarimirror.comsarkaritelSaurabh Chandrasaurabh chandra petroleum secretarySBIscientists of indiascope directorySCOPE HR Summit 2015scope hr summit newsscope newsscope telephone directoysebiSecond Session of the UNESCAP Working Group on Asian and Pacific Decade for Persons with DisabilitiesSecretary (Health)secretary amitabh kantsecretary ashok lavasasecretary indiasecretary of indiaSecretary of Ministry of Skill Development and EntrepreneurshipSecretary of Ministry of Skill Development and Entrepreneurship Sunil AroraSectorssecuritysenior Government representatives from 15 countries and 15 Civil Society Organizations in the Asia Pacific RegionSergey NaryshkinSesquicentennial function of Advocates' Association of Western IndiaSHAHRUKH KHANShaikh Khalid Bin Mohamed Al Khalifasharad pawarSharda UniversityShatrughan SinhaShivraj Singh ChouhanShri Anant Kumar SinghShri Arun Jaitley briefing the media about the deliberations of the first meeting of the Governing Council of NIITI Aayog chaired by the Prime MinisterShri Narendra ModiShri Raman SinghShri Rao Inderjit SinghShri Shingaji Thermal Power ProjectSIATSIDELINED BCCI CHIEFsigning of the agreements between Kamarajar Port Ltd. and Toyota Kirloskar motor Pvt. Ltd.Sikh RegimentsingaporeSir Ashutosh Mookerjeesir ganga ram hospitalSir Nicholas Patrick CarterSmall and Medium Enterprisessmriti iraniSneh Lata KumarSocial Justice & EmpowermentSocial MediaSocial securitySoil Health Cardsonia gandhisouth block of rashtrapati bhavanSpanish Defence Ministerspeaker of lok sabhasportssports news top sports newsSri Sri Ravi Shankarsrinagar newsSRKStage I of Shri Shingaji Thermal Power Project to the nation at KhandwastateSTATE BANK OF INDIAState Civil Servicesstate government newsstate government of indiastate governments of indiaStatesStatisticsStatus of Tigers in India 2014stiture Parade of Railway Protection Forcestock exchange of indiaSTYLIST AAMER ZAKIRSudarshan Bhagatsudhir bhargavasunil arorasupreme court of indiaSupreme Head of the Universal Syrian Orthodox ChurchSuratgarh Military StationSuratgarh Military Station in rajasthanSuresh Prabhakar PrabhuSuresh Prabhakar Prabhu launching a ‘Customer Complaint Web Portal and Mobile Application’sushma swarajswachh bharatSwami Shantatmanandaswine flu in Telanganasymbiosissymbiosis universitysymbiosis university puneSymposium on International Automotive TechnologyT. R. ZeliangT. Suvarna Rajutableau of cpwd republic dayTableaux ArtistesTableaux Artistes republic day parade 2015Takehiko NakaoTARUN TEJPALtaxTechnologyTechnoogytehelkaTELANGANA NEWSTelecom Servicestelegram sent by USA to the Indian Constituent Assembly in 1946telephone directory of governmenttelephone directory of government of indiatelephone directory of government officials of indiatex trends fairtex trends fair 2015Thaawar Chand GehlotThe Ambassador of Poland to IndiaThe Ambassador of the Republic of KoreaThe Ambassador-designate of United States of Americathe Calcutta High Court Chief Justicethe Central Adoption Resource Authoritythe Central Board of Excise and CustomsThe Chairmanthe Chairman of State Dumathe Chief Advisor to President of Islamic Republic of Iran and Secretary of Council for Free TradeThe Chief Economic AdviserThe Chief Election CommissionerThe Chief Minister of Biharthe Chief Minister of ChhattisgarhThe Chief Minister of DelhiThe Chief Minister of GujaratThe Chief Minister of HaryanaThe Chief Minister of Himachal Pradeshthe Chief Minister of Madhya PradeshThe Chief Minister of MaharashtraThe Chief Minister of ManipurThe Chief Minister of NagalandThe Chief Minister of PuducherryThe Chief Minister of RajasthanThe Chief Minister of TripuraThe Chief Minister of Uttar PradeshThe Chief of Army Staffthe Chief of Gen. Staffthe Chief of Naval Staffthe Commerce MinisterThe Commerce SecretaryThe Defence SecretaryThe DG NCCThe Director General AADthe Director General Coast GuardThe Director of the International Department of the Central Committee of the Communist Party of Chinathe election commissionerthe ENDOLAP 2014- Third Biennial International Conference and Advanced Live Laparoscopic WorkshopThe Finance Minister of Republic of Turkeythe Foreign Minister of BahrainThe former Chief Minister of J & KThe former Director of Indian Institute of ScienceThe former PresidentThe former President of MaldivesThe French Defence Ministerthe General & Census CommissionerThe Global CEOThe Governor of GoaThe Governor of Gujaratthe Governor of Haryanathe Governor of Jammu and Kashmirthe Governor of KarnatakaThe Governor of Madhya Pradeshthe Governor of West Bengalthe Health Ministerthe highest gallantry award Ashok ChakraThe Indian Boxerthe Indian Constituent Assemblythe Indian Machine Tool Manufacturer’s Associationthe International Mother Language DayThe Jr. Commanderthe Krantiguru Shyamji Krishna Verma Kachchh Universitythe launch of the National Deworming initiativeThe Lt. Governor of Andaman & Nicobar Islandsthe Minister for Agriculturethe Minister for Minority Affairs of Maharashtrathe Minister of CultureThe Minister of Defence and General of Army of Russia Sergey K. Shoyguthe Minister of EducationThe Minister of Foreign Affairs of JapanThe Minister of Health and Medical Services of Fijithe Minister of Industry and Tradethe Minister of Industry and Trade Czech Republic Jan MladekThe Minister of International Relations and CooperationThe Minister of Labour of CanadaThe Minister of State (Independent Charge) for Powerthe Minister of State for Chemicals & FertilizersThe Minister of State for Commerce & IndustryThe Minister of State for Consumer AffairsThe Minister of State for Culture (Independent Charge)The Minister of State for FinanceThe Minister of State for Heavy Industries & Public EnterprisesThe Minister of State for Home (Rural)The Minister of State for Home Affairsthe Minister of State for Human Resource DevelopmentThe Minister of State for Information & Broadcastingthe Minister of State for Labour and EmploymentThe Minister of State for Labour and Employment (Independent Charge)The Minister of State for Micro Small & Medium EnterprisesThe Minister of State for Minority Affairs and Parliamentary AffairsThe Minister of State for Petroleum and Natural GasThe Minister of State for Petroleum and Natural Gas (Independent Charge)The Minister of State for Planning (Independent Charge) and DefenceThe Minister of State for Railwaysthe Minister of State for Road Transport & Highways and ShippingThe Minister of State for Rural DevelopmentThe Minister of State for Science and Technology and Earth ScienceThe Minister of State for Skill Development & Entrepreneurship and parliamentary affairsthe Minister of State for Social Justice & Empowermentthe Minister of State for Statistics and Programme Implementation (I/C)The Minister of State for Urban Developmentthe National Deworming initiativethe National Librarythe National Science Day Lecture on “Science for Nation Buildingthe North Eastern Region MSMEs Conclave 2015The Parliamentary State SecretaryThe Peranakan World - Cross Cultural Art from Singapore and the Malacca Straitsthe presentation of Standards to 21 SQN & 116 HU of Indian Air ForceThe President Asian Development BankThe President of the Association of Biotechnology Led EnterprisesThe President of the Democratic Socialist Republic of Sri Lankathe President of the Republic of SingaporeThe Prime Minister of Macedoniathe Railway Budget 2015-16the Raksha Mantri’s Trophythe Second Minister for Trade & Industry of SingaporeThe Secretarythe Secretary (BM)The Secretary Ministry of Culture Ravindra SinghThe Secretary Ministry of TourismThe Secretary Ministry of Tribal Affairsthe Secretary of Delhi Ramakrishna MissionThe Spanish Defence Ministerthe State Level Khadi Gramodyog Exhibitionthe State Level Khadi Gramodyog Exhibition in guwahatiThe tableau of GoaThe tableau of Goa on rajpathThe tableau of Goa on rajpath on republic dayThe tableau of Indian NavyThe tableau of KarnatakaThe tableau of Maharashtrathe tableau of ministry of railwaysThe tableau of the Department of Financial ServicesThe tableau of the Department of Financial Services at republic dayThe tableau of the Ministry of Indian RailwaysThe tableau of the Ministry of Indian Railways on rajpathThe Tennis PlayersThe UGC ChairmanThe Union Minister for AgricultureThe Union Minister for Agriculture senior officials of ICARThe Union Minister for Chemicals and FertilizersThe Union Minister for Civil AviationThe Union Minister for Communications & Information TechnologyThe Union Minister for Defencethe Union Minister for External Affairs and Overseas Indian Affairsthe Union Minister for FinanceThe Union Minister for Health & Family WelfareThe Union Minister for Heavy Industries and Public EnterprisesThe Union Minister for Human Resource DevelopmentThe Union Minister for Law & JusticeThe Union Minister for MicroThe Union Minister for Minority AffairsThe Union Minister for RailwaysThe Union Minister for Road Transport & Highways and ShippingThe Union Minister for Rural DevelopmentThe Union Minister for Social Justice and EmpowermentThe Union Minister for Tribal AffairsThe Union Minister for Urban DevelopmentThe Union Minister for Water ResourcesThe Union Minister for Women and Child DevelopmentThe US PresidentThe Vice Chairmanthe Vice Chancellor of Maulana Azad National Urdu University (MANUU)the Vice President of the Asian Development Bankthe Voters’ Day Pledge at Kamla Nehru Collegethinkedu conclaveThird Biennial International Conference and Advanced Live Laparoscopic WorkshopThiruvalluvar Daytimes of indiatimes of india epaperTofail Ahmedtokyo newsTomasz Lukaszuktop 10 news websites of indiatop 10 websites of indiatop banks of indiatop bureaucracy websitestop bureaucrats of indiatop defence newstop defence news websites of indiatop educational institutestop english news websitesTOP FASHION NEWS OF INDIAtop global newstop governance websitestop government newstop government news websitestop government news websites of indiatop indian political newstop indian political news websitestop international newstop news of indiatop news storiestop news websitestop news websites of indiatop political newstop political news in indiaTOP POLITICAL NEWS WEBSITEStop political sitestop political web sitestop political websitestop psu newstop ten news websites in the worldtop ten news websites of asiatop ten news websites of indiatop ten websites of indiaTourism (Independent Charge) and Civil AviationTourism and Marketing of MaharashtraToyota Kirloskar motor Pvt. Ltd.Trade &transportationtribal food festivalTshering TobgayTughlakabadtwo-day National Thematic Workshop on the ‘Best Practices for Women and Child Development’UdyanotsavUdyanotsav of mughal gardenUKuk defence newsUNUN Genral SecretaryUNAUDITED FINANCIAL RESULTS OF NATIONALISED BANKS OF INDIAUNDERGROUND RESERVOIRS OF DELHI JAL BOARDUNESCAPUnileverUnion Home Ministerunion minister for raiwaysUnion Minister for Road Transport & Highways and Shippingunited kingdom defence newsunited nationsunited nations general secretaryUniversity of Delhiuniversity of lucknowuniversity of lucknow convocationUPUP CMup cm akhilesh yadavUPA MINISTER KRISHNA TIRATHupdated government newsupdated newsUpendra KushwahaUrban Auxiliary Nurse Midwifeus ambassador to indiaus president arack Obama inspecting the Guard of Honourus president barack obamaus president during india visitUS Secretary of CommerceUS Secretary of StateUTUtilitiesUTsUwe BackmeyerVajubhai RudabhaiValedictory Session of the Pravasi Bharatiya Divas 2015VARDAAN DOCUMNTARY FILMvarun dhawanVasundhara Raje Scindiavibrant gujaratVibrant Gujarat Global SummitVice Admiral Anurag G. Thapliyalview of the illuminated Rashtrapati BhavanVijay SamplaVinayak Shah Marge & Dorabi Tata MargeVirbhadra SinghVisaVision 4G-India’s next Telecom Revolutionvisitor’s book at the Amar Jawan Jyotivoter id applicationvoter id cardvoters card list of indiaVOTERS DAYWang Jiaruiwater newsWencai ZhangWest Zone Cultural CentreWest Zone Cultural Centre Udaipurwhats happening in indiaWHITE DESERTwho is delhi chief ministerWHO IS THE CURRENT MD OF PUNJAB NATIONAL BANKWHO IS THE EXECUTIVE DIRECTOR OF PNBwife of vice president of indiaWildlife Crime Monitoring SystemsWinners of the National Bravery Awards-2014Wirelessworkshop on ‘Performance Evaluation and Management of State Owned Enterprisesworkshop on National Aviation Universityworkshop on Streamlining Government CommunicationWorkshopsworld best political newsworld best political news websiteworld best political news websitesworld breaking newsworld embassies indiaworld government newsWorld Leprosy Dayworld newsWorld Toilet Summit 2015Y.S. Chowdaryyair shamirYakovlevs - a four aircraft display team from UKYami GautamYelahankazeenewsZoological Survey of Indiazsi
The President, Shri Pranab Mukherjee presented the 8th National Biennial Award for..
Current News

The President, Shri Pranab Mukherjee presented the 8th National Biennial Award for..

sarkarimirror March 7, 2015

The President, Shri Pranab Mukherjee presented the 8th National Biennial Award for Grassroots Innovations and outstanding Traditional Knowledge, at Rashtrapati Bhavan, in New Delhi on March 07, 2015. The Union … Read More

. The Minister of State for Road Transport & Highways and Shipping P. Radhakrishnan‘National conference on Strengthening of Cooperative - Education and Training system“Beti Bachao14th World Toilet Summit 2015150th birth anniversary celebrations of Sir Ashutosh Mookerjee15th International Seminar on “Counter IED Strategy15th International Seminar on “Counter IED Strategy by nsg19th convocation Ceremony of NIMHANS2013-2022 in New Delhi2015. The Vice Chairmen of NITI Aayog20th Meeting of the Central Zonal Council21st International Conference & Exhibition on Terrestrial and Satellite Broadcasting24th Admiral R.D. Katari Memorial lecture29th Arunachal Statehood Day29th Arunachal Statehood Day function29th meeting of the Central Consumer Protection Council400kV GIS sub-station44th Battalion Rashtriya Rifles4th India International Potato Expo-201553rd Annual Session of Cement Manufacturers’ Association66th republic day celebration of india66th Republic Day of india67th army day7th Vibrant Gujarat Global Summit 20158th National Biennial Awards for Grassroots Innovations and outstanding Traditional KnowledgeA. SethumadhavanA. Sethumadhavan chairman of national book trust of indiaA.K. MitalaajtakAAM AADMI PARTYAAMER ZAKIRAAMER ZAKIR INTERVIEW IN SARKARIMIRRORAAMER ZAKIR INTERVIEW WITH TARUN SHARMAAAMER ZAKIR INTERVIEWSAAMIR KHANaapAAP LEADER ASHUTOSHAcute Encephalitis SyndromeAdditional Member (Commercial) Railway BoardAdditional Secretary (Centre-State)Addl Secy. (Health)Adi Sankara’sAdi Sankara’s lifeAdmiral Harry HarrisAdmiral R.D. KatariAdmiral R.K. DhowanAdvocates' Association of Western IndiaAero India-2015Aero India-2015 Air ShowAESafr of psuAGMagm of psuagricukture newsagricultureAgriculture Minister of Israelagriculture newsaiccaicc chiefAir Chief Marshal Arup RahaAir Marshal J.S. Klerairline operators in indiaairlines in indiaAjay ShuklaAkbar Torkanakhilesh yadavAll India Citizens’ Alliance for Progress & DevelopmentALL INDIA CRIME NEWSAll India Federation of the Deaf’All India Federation of the Deaf’ PresidentAll India Federation of the Deaf’ President Kum. Surrender SainiAll India Shwetamber Sthanakvasi Jain ConferenceAll India Shwetamber Sthanakvasi Jain Conference presidentAll India Shwetamber Sthanakvasi Jain Conference spiritual mahakubh indoreAll India Shwetamber Sthanakvasi Jain Conference spiritual mahakumbhAmar Jawan JyotiAmbassador of China to Indiaambassadorsambassadors of indiaambassadors of various contries in indiaambassadors to indiaambassadors to india from across the globeamitabh kantAmitabh Kant secretaryanandiben patelanant GeeteAnanthkumarAnil SwarupANMAnti LeprosyAnti Leprosy dayAnti Leprosy FortnightAnti Leprosy weekApplicationsarack Obama inspecting the Guard of Honour during india visitarmuy daiAROON PURIEarun jaitleyArunachal Statehood DayArundhati Bhattacharyaarvind kejiwalarvind kejriwal delhi chief ministerArvind Panagariyaashok chakraAshok Gajapathi Raju PusapatiAshok LavasaASHUTOSHasia newsasian development bankASSOCHAMAssociate professor Department of biochemistryAssociation of Chambers of Commerce& Industries in IndiaAt Home` reception of US President Barack obama in new delhi oon 66th india republic dayat the inauguration of the DGNCC Republic Day Camp 2015at the World Book Fairat the World Book Fair-2015AUDITED FINANCIAL RESULTS OF NATIONALISED BANKS OF INDIAaustralian senatorautonomous bodies of indiaaviation newsB S BASSIB.P. SharmaBabul Supriyobabusbabus of indiaBAE Systemsbahrain newsbahujan samaj partyBalmerLawrie& Co. LtdBan Ki-moonBand performing at the Beating the Retreat CeremonyBand performing at the Beating the Retreat Ceremony at rashtrapati bhavanBandaru DattatreyaBangaloreBank MitrBANKSbanks in indiaBarack Obamabarack obama india visit on republic dayBarack Obama paying floral tributes at the Samadhi of Mahatma Gandhibaramati newsbasic needsbbcBC AGENTSBCCI CHIEFbeating retreatbenefits the societyBengal Global Business SummitBES EXPO-2015BEST BANKS OF INDIAbest diplomacy newsbest diplomacy websitesBEST DOCTORS OF SIR GANGA RAM HOSPITALbest entertainment newsbest news of indiabest news websitesbest political sitesbest political websitesbest political websites of indiabest Road Safety PracticesBeti hai to kal haiBeti Padhao logoBHARAT ELECTRONICS LTD.Bharat Rang MahotsavBharat Rang Mahotsav organised by National school of dramaBhuj newsBhupendrasinh M. Chudasamabhutan newsBicentenary Celebrations of Gorkha Riflesbimal julkaBimal Julka inaugurating the Display of Publications Division’s books at the World Book Fair-2015Birth Anniversary Celebration of Swami VivekanandbjpBJP PRESIDENTboard members of indian railwaysbodhi plantbollywood newsBollywood starsbombay high court museum officialsBook of the Institute of Indian LanguagesBook of the Institute of Indian Languages Mysorebook on Adi Sankara’s lifebook on Adi Sankara’s life and teachinsbook Quarterdeckbook release India–2015 Reference Annualbooks by northern railwaysbooks published by northern railwaysborder haatborder hatt at srinagarBorder Security ForceBranding ideasbreaking newsbreaking news of indiaBRICS International Youth Forum 2015britains BAE Systems for Indian Air ForceBSEbse quotesbspbudget session of parliament of india 2015bureaucracybureaucracy todaybureaucracy today in indiabureaucratsbureaucrats in indian politicsBUREAUCRATS NEWSbureaucrats of indiaBusinessbusiness entertainment news in ENGLISH about india local news onlinebusinessworldC.K. Mishracabinet ministers of indiaCadet Sergeant Shubham Bairagicadets from Jammu & KashmircaraCENSER BOARD CHIEFCENSOR BOARD OF INDIACentenary Celebrations of by Zoological Survey of IndiaCentenary Celebrations of ZSIcentral government directorycentral government newscentral government of indiaCENTRAL RAILSIDE WAREHOUSING CORPORATION LTD.CEO DELHI JAL BOARDCEO DJBceo helpage indiaCEO OF DELHI JAL BOARDceo poscoCEO-Designate Allianz Group of GermanyChairman and Managing Director of National Research Development Corporationchairman of hindustan aeronauticals ltdchairman of national book trustchairman of psuchairman of visitbritainCHAIRMAN SPEECH OF GOVERNMENT BANKS OF INDIACHAIRMAN SPEECHES OF BANKS IN INDIAchairmans of psuCHAIRPERSON SBICHANDIGARH NEWSChaudhary Birender Singhchennai newsChhattisgarhCHIEF ELECTION COMMISIIONERchief justice of indiachief manager of psuChief Minister of GujaratChief Minister of HaryanaChief Minister of KeralaChief Minister of Madhya Pradeshchief ministers of indiachief ministers of statesChief of Army Staffchief of the air staff indiachina newsCHRISTIAN COMMUNITY NEWS IN INDIAChristopher Rodriguezcitation for the Best Service Hospital to Command Hospital (SC)Citizen Journalistcivil aviation minister of indiacivil aviation newsclosing ceremony of the National Tribal Festival- 2015 VANAJcm akhilesh yadavcm delhi inaugrates dwarka water treatment plantCMDcmd air indiacmd bhelcmd bsnlcmd delhi tourismcmd ficcicmd gailcmd hudcocmd irconcmd irctccmd licCMD MTNLcmd nalcocmd national insurancecmd nhpcCMD NRDCcmd ntpccmd obcCMD of Biocon Limitedcmd of indian psucmd of psucmd of psu of indiacmd ongccmd oriental bankcmd pnbCMD POSCO INDIAcmd powerfinancecmd powergridCMD Punjab & Sind Bankcmd railtelcmd reccmd ritescmd sailcmd scicmd sidbicnbcCNN IBN EDITOR ASHUTOSHCoal and New & Renewable EnergyCoal and New and Renewable EnergyCoal and New and Renewable Energy the Minister of State (Independent Charge) for PowerCoal and NRECol. Rajyavardhan SinghCol. Rajyavardhan Singh RathorecolumnCOMEDIAN KAPIL SHARMAComedy Nights With Kapil.CommerceCommunicationsComputerconference on pahalcongresscongress partyConnectivityCONSTABLE AJMERSINGHConstitutionconsulate of indiaConsultative Workshop on Urban GovernanceContest for PMO Mobile App developmentController General of Defence AccountsCorporate Affairs and Information & BroadcastingCosmology and Astrophysics Research Group Centre for Theoretical Physicscpwdcpwd newscpwd tableau at rajpath on republic dayCRIME NEWScurremnt newcurrent affairscurrent affirscurrent chairman of hindustan aeronauticals ltdcurrent cmd of ntpccurrent newscurrent speaker of lok sabhaCzech RepublicD.V. Sadanandadare devil stunts of motorbike riders of Border Security ForceDASDatacentersdefence newsdefence personnels of indiaDefence Researchdefence websites of indiadefenseDelhi Administration Subordinate Service Cadredelhi assemblydelhi assembly elction newsdelhi assembly elections 2015delhi assembly elections latest newsDELHI CHIEF MINISTERdelhi crime newsdelhi deputy chief ministerdelhi economic surveydelhi governmentdelhi government newsdelhi jal boarddelhi jal board ceoDELHI JAL BOARD CHAIRPERSONDELHI JAL BOARD DWARKA WATER TREATMENT PLANTDELHI JAL BOARD HEAD OFFICEdelhi jal board newsDELHI NEWSdelhi policedelhi police commissionerDELHI POLICE EAST DELHIdelhi police head quarterdelhi police head quartersDELHI POLICE SPECIAL STAFFDELHI POLLSDELHI POLLS DATEDELHI TRANSPORT ROAD SAFETY WEEKDELHI TRASPORT NEWSDELHI WATER SUPPLIERSdeli police newsDepartment of Atomic EnergyDepartment of Electronics and Information TechnologyDepartment of Empowerment of Persons with DisabilitiesDepartment of Financial ServicesDepartment of Industrial Policy and PromotionDepartment of Spacedeputy chief minister of delhiDeputy Prime Minister of PolandDevelopment and Technology CooperationDevendra FadnavisDGDG (Inspection & Safety)dg J. N. Chakarvatidg nccDG NCC Republic Day Camp 2015dg nsgDGNCC Republic Day Camp 2015Dharmendra Pradhandiplomacy websitesdiplomacy websites in indiaDirector GeneralDirector General (M&C)directory of central governmentdirectory of embassies consulates in indiadirectory of government of india officialDisaster ManagementDiscussion boardDistrictsDivya Singh Deo GajapatiDJB introduces Online Complaint Registration and Status Check Facility for its consumersDoordarshandr m ravikantDr. A.P.J. Abdul KalamDr. Amita GuptaDr. Arup Roy ChoudhuryDr. Arvind SubramanianDr. C. ChandramouliDr. H. PandaDr. Hanumanthu PurushothamDr. Jitendra SinghDr. K.K. PaulDr. Kellie LeitchDr. Lalit K. PanwarDr. Mahesh SharmaDr. Najma A. HeptullaDr. P. BalaramDr. P. C. KokilaDr. Rajendra Prasad Sarvodaya VidyalayaDr. Rakesh KumarDr. Raman SinghDr. Syed Nasim Ahmad ZaidiDr. Tony Tan Keng YamDr.RAM .S.SANGAPUREDrinking Water and Sanitatione governanceE-book of Ministry of EnvironmentEconomic Growtheconomic surveysEconomicsED GAURI SHANKAREducationeducational institutes in greater noidaeIndiaEknath Khadseelection commisiionELECTION COMMISSIONELECTION COMMISSION OF INDIAelections model code of conductElectoral Roll databaseembassies abroad indiaembassies in delhiembassies in indiaembassies of indiaENGLISH newsENTERTAINMENT NEWSEnviornmentEnvironmenterickshawserickshaws association in delhierickshaws in delhiesic chennaiethiraj college for womeneurope newseuropre newsEXCHANGE4MEDIAExecutive Director PUNJAB NATIONAL BANKExternal Affairs and Overseas Indian Affairsfarmers newsFarmers RallyFarmers Rally at baramatiFASHION DESIGNER AAMER ZAKIRfashion designers in indiafather of nation mahatma gandhiFederal Assembly of Russian FederationFICCIFijiFINANCEfinance newsfinancial institutes in indiaFINANCIAL RESULTS OF BANKSFirst Lady Michelle ObamaFirst Visitors Award-2015 for the Research 2015flying Russian origin Yak aircraftFood and Public Distributionforeign ambassadors in indiaforeign embassies and consulates in indiaForest and Climate ChangeForests and Climate ChangeFORMER JOURNALIST SANTANU SAIKIAfoundation day of NCPCRFoundation Stone laying Ceremony of the Centre of Excellence for Vegetable Development in BaramatiFoundation Stone laying Ceremony of the Centre of Excellence for Vegetable Development in Baramati by prime minister of indiaFrench Defence Ministerfull dress rehearsal for the Republic Day Parade-2015Fumio KishidaG.M. Siddeshwaragallantry award Ashok ChakraGandhigandhi familyGandhi Peace FoundationGandhi SmritiGANDHINAGARGANDHINAGAR NEWSgauri shankarGee Woong SungGeneral (Retd.) V.K. SinghGeneral Budget 2015-16General Dalbir SinghGENERAL KNOWLEDGEGeneral Managers PR of psuGeneral Zhang YouxiaGermanygermany newsgfilesindiagiriraj singhGISGLOBAL NEWSglobal news websitesgm of psugoernment of jaipurGoIgoi officialsGolden Jubilee Celebrations of R.V. College of Engineeringgorkha riflesgovernancegovernance newsgovernance nowGoverning Council of NIITI Aayoggovernment contact directorygovernment contact listgovernment contactsgovernment directorygovernment jobsGOVERNMENT JOBS IN INDIAGovernment Law CollegeGovernment Law College Mumbaigovernment newsgovernment news indiagovernment news of indiaGOVERNMENT OF DELHI NEWSGOVERNMENT OF GUJARATgovernment of indiaGovernment of india contact numbersgovernment of india newsgovernment of india news todaygovernment of india official contactgovernment of india official contact detailsgovernment of india official contact numbersgovernment of india official contactsGOVERNMENT OF INDIA OFFICIALSgovernment of india officials newsgovernment of india telephone directorygovernment of india websitesGovernment of Madhya PradeshGOVERNMENT OF NCT OF DELHIGovernment of RajasthanGovernment of the People's Republic of Bangladeshgovernment phone directorygovernment psu of indiaGOVERNMENT PSU OF INDIA NEWSgovernment telephonegovernment telephone directorygovernment telephone numbersgovernment tendersgovernnanceGovernor of UttarakhandGovt IssuesGuard of Honour during the presentation of Standards to 21 SQN & 116 HU of Indian Air Force in Jodhpurgujaratgujarat newsGujarati Association malaysiaGujarati AssociationsGujarati translation of ThirukkuralH.S. BramhaHALhal bangalorehamid ansarihamid ansari office addressHansraj Gangaram Ahirhappening news of indiaHaribhai Parathibhai ChaudharyHARISHANKAR BRAHMAHAWK MK 132 simulatorhe Minister of State for Development of North Eastern RegionHead of General Armament Department of the PLA and the member of CMChead quarters of delhi policeheadlines in cricketheadlinestodayHeads of Mission Conferenceheads of psu of indiahealth issueshealth newsHealth Sustainabilityhelpage indiaHelpline for Drug De-AddictionheritageHeritage City Development and Augmentation Yojanahigh commission in delhihigh commission in new delhihighlights of union budgetHIGHLIGHTS OF UNION BUDGET 2015Hight CourtHind Kusht Nivaran Sanghhindustan aeronauticals ltdhindustan aeronauticals ltd chairmanHindustan Aeronautics LimitedHindustan Aeronautics Ltdhindustan timeshindustan times epaperhome minister of indiahome secretary L.C. Goyal.who is the home secretary of indiahorticulturehorticulture newshorticulture updtaeshospitalsHotel TridentHousing and Urban Poverty AlleviationHousing and Urban Poverty Alleviation and Parliamentary AffairsHRIDAYHTT-40 trainerhuco newsHUDCOhudco bhawan at new delhihudco bhawan at salt lakeHUDCO CMDHUDCO NEWShudco office in new delhiHuman RightsHYDERABAD NEWSIAASiafIAF Republic Day Parade 2015 marching contingentiariIASias dr m ravikantIAS HARISHANKAR BRAHMAIAS OFFICERSias officers of indiaias preparationsIBAIBA BANKING TECHNOLOGY AWARDibn7ibn7 nwsibnliveIESIFoSifsiisimphal newsIMTEX and Tooltech-2015in New Delhiin New Delhi on February 08inadian army newsinaugration of delhi jal board water treatment plant by arvind kejriwalinaugration of India Water Week 2015inaugration of Multimodal Manufacturing Project of GEinaugration of Multimodal Manufacturing Project of GE by narendra modiinaugural ceremony of the 63rd All India Police Wrestling Cluster 2014-15inaugural ceremony of the 63rd All India Police Wrestling Cluster 2014-15 organised by itbpinaugural session of the 14th World Toilet Summit 2015inauguration of the 7th Vibrant Gujarat Global Summit 2015inauguration of the AIR Chennai’s broadcast of Vividh Bharati on FM channelinauguration of the National Meet on Adoptioninauguration of the New Railway Line between Hazaribag and Kodarma in Jharkhandinauguration of the Oil & Gas Conservation Fortnight of PCRA 2015inauguration of the Public Art Innovation on sustainability “Ganga Waterfront”INCOME TAXincome tax commissionerincome tax departmentincome tax department of indiaincredible indiaindiaindia 7th Agricultural Summitindia air chiefindia best bureaucracy websiteindia best english news websitesindia best news websitesindia best political newsindia best political news websiteIndia Breaking Newsindia bureaucratsINDIA CENSOR BOARDindia chief justiceINDIA CHRISTIAN COMMUNITY NEWSindia civil aviation ministerindia civil aviation newsindia curent affairsindia current affairindia current affairsindia defence newsindia election newsindia fashion newsIndia Gateindia general newsindia home ministerindia horticulture newsindia ias officersindia international newsIndia International Potato ExpoIndia International Potato Expo-2015india khadi industriesindia latest newsindia list of ias officersindia list of ips officersindia nationalised banksindia netasindia newsindia news websitesindia parliament houseindia parliamentariansindia parliamnet newsindia police commissionersindia political newsINDIA POLITICAL PARTIESindia prominent scientistsindia railways tableau at 66th republic dayINDIA REPUBLIC DAYindia republic day beating retreatindia republic day newsindia resultsgovernment jobsindia sarkari babusindia sarkari newsindia Sikh Regimentindia space research organisationindia state governmentsindia todayindia top banksindia top bureaucratsindia top government news websitesindia top n ewsindia top newsindia top news websitesindia top political sitesindia top psu newsINDIA TOP TEN BANKSindia top ten news websitesindia updated newsindia vice presidentindia votersIndia Water Week 2015India-US Strategic DialogueIndia–2015 Reference AnnualIndia–2015 Reference Annual book releaseIndia’s new visa shift and synergies between Britain and Indiaindia’s top 10 bureaucratsINDIAN ADMINISTRATIVE SERVICESIndian Agricultural Research Instituteindian air forceindian air force newsindian ambassador to the united statesINDIAN AMBASSADORSindian armyindian babusINDIAN BANKING ASSOCIATIONINDIAN BUREAUCRACTSindian bureaucracyindian bureaucrats blogINDIAN BUREAUCRATS LISTIndian Coal Story – Prospects and Challengesindian defence newsindian diplomacyINDIAN DIPLOMATSindian diplomats contact numberindian diplomats newsIndian Economyindian embassyindian financial instituesindian governanceindian governance top news websitesindian governmentindian government contactindian government contact detailsindian government contact numbersindian government dirctoryindian government home secretaryindian government newsindian government official websiteindian government phone directoryindian government websitesindian ias officersindian militaryindian military newsindian national congress partyINDIAN NAVRATNASindian ngoindian nri newsINDIAN POLICE SERVICESIndian political newsindian politicsindian politics newsINDIAN PREMIER LEAGUEIndian PSUindian psu headsindian railway boardindian railway board membersindian railway budgetindian railway budget 2015indian railwaysindian railways newsindian railways officialsindian states newsindiatodayindira gandhiIndo Tibetan Border Police ForceINDO-US RELATIONSHIPIndustrial and SEZsIndustriesInformation TechnologyinfrastructureInia Batikoto SeruiratuInstitution of Permanent Way EngineersintegratedINTELECT-2015 & UPTO 11kv exhibitionINTELECT-2015 & UPTO 11kv international exhibitionIntermediate Jet TrainerInternational Customs Day 2015international government newsinternational Gujarati Associationsinternational newsinternational news websitesInteroperableINTERVIEWS OF TOP FASHION DESIGNERS OF INDIAInveInvestiture Ceremony 2015IPLIPSipweipwe indiairsISROisro chiefITit minister of indiait ministryitbpitbp newsITSJ. N. ChakarvatiJ. N. Chakarvati dgJagat Prakash NaddaJaguar Darin-IIIjaipur newsJamia Milia IslamiaJammu and Kashmir newsJammu UniversityJan MladekJanusz Piechocinskijapan newsJapanese EncephalitisJayant SinhaJayanthi SirisenaJEJean Yves Le DrianJHARKHAND NEWSJim Yong KimJitan Ram Manjhijohn kerryJoint SecretaryJoint Workshop on Skill Development and EntrepreneurshipJoint Workshop on Skill Development and Entrepreneurship in new delhiJone UsamteJoon-Gyu LeeJS (RMNCH+A)Jual Oramjual ramK BISWALK U THANKACHANK. RadhakrishnanK.V. Brahmaji RaoKailash Mansarovar Yatra 2015Kailash SatyarthiKalraj MishraKamarajar Port Ltd.Kapil SharmaKAPIL SHARMA COMEDIANKarnataka & GoaKeshari Nath TripathiKhadikhadi gramudyogkhadi industry in indiakhadi newsKiran Kumar Alur SeelinKiran Mazumdar ShawKiren RijijuKMY website & bilingual Interactive Voice Response System (IVRS)kolkata newsKolkata.Krishan PalKrishna TirathKRISHNA TIRATH DALIT LEADERKum. Surrender SainiKwon Oh-JoonL.C. GoyalLALU YADAVlatest amabassadors of indialatest baramati newslatest bureaucrats newslatest bureaucrats of indialatest chairperson of delhi jal boardlatest china newsLATEST CRIME NEWSlatest defence newslatest delhi government newslatest delhi jal board newslatest europe newslatest fashion newslatest finance newslatest government newslatest high commisions in indialatest hudco chairmanLATEST HUDCO CMDlatest hudco newslatest ias officerslatest india newslatest indian railways newslatest internationla newslatest ips officerslatest itbp newslatest jharkhand newslatest military newslatest ncc newsLatest Newslatest news from indialatest news of government of madhya pradeshlatest news of indialatest ntpc newsLATEST PATNA NEWSlatest political newslatest political news indialatest political news of indialatest prime minister of indialatest psu newslatest railway budgetlatest rss newslatest water newslatest world newslatets crime newslatets enws of indialaunch of the “2015 – Year of Active Pharmaceutical Ingredientslaunch of the Venture Capital Fund for Scheduled CastesLawrence WongLe YuchengLEANDER PAESLEELA SAMSONLEELA SAMSON CENSER BOARD CHIEFLeprosy Seal CampaignLight Combat AircraftLight Combat HelicopterLight Utility Helicopterlisa singhlist of ambassadors in indialist of chief ministers of statelist of cmd of india psulist of diplomatic missions of indialist of indian bureaucratslist of top navratnasLord Ian LivingstonLov VermaLt Gen V.K. SaxenaLt. Gen. A. ChakravartyLt. Gen. Aniruddha ChakravartyLt. General (Retd.) Shri A.K. Singhlucknow newsm-Governmentmadhuri dikshitmadhya pradesh chief ministermadhya pradesh newsmadras high courtmadras high court newsMahabodhi templeMaharaja of Purimaharajas of jaipurmaharshtra mla’smahatma gandhimahatma gandhi statuemahatma gandhi statue at gandhinagarMaite Nkoana-MashabaneMaithripala SirisenaMajor Mukund VaradarajanMajor Mukund Varadarajan 44th Battalion Rashtriya RiflesMANAGING DIRECTOR CRWCManeka Sanjay GandhimangalyaanManik Sarkarmanipur newsmanish sisodiaManjula ChellurManohar Lal KhattarManohar ParrikarManoj SinhaMartina HingisMartina Hingis and Leander Paesmartyr's dayMARY KOMMary Tanmatdan mahotsavMathews Cherian ceoMathews Cherian ceo helpage indiaMathribhasha DiwasMathribhasha Diwas celebrationsMaumoon AbdulMCC Chamber of Commerce & IndustryMCC Chamber of Commerce & Industry kolkatamcdmcd commissionermcd newsmeeting of the Central Consumer Protection CouncilMehmetMember of Parliament.Member Trafficmembers of parliament of indiaMHAMilitarymilitary newsminister giriraj singhMinister of State for Culture (Independent Charge)Minister of State for Trade & Investment of UKMinister of State with Independent Charge for Powerministers indiaministers of indiaministries and departmentsministries contact numbersministries of govt. of indiaMINISTRIES OF INDIAministry for developmentMinistry of CoalMinistry of CultureMinistry of FinanceMinistry of Home AffairsMinistry of Information and Broadcastingministry of msmeministry of petroleumMinistry of Petroleum & Natural GasMinistry of PowerMinistry of ShippingMirage upgradeMLAmla’s of indiamodel code of conductmodel polling boothMODI LUNCH AT PARLIAMENT CANTEENMODI TAKING LUNCH AT PARLIAMENT CANTEEN NEWSmohan bhagwat latest newsMOHFWMOTHER TERESAmotorbike riders of Border Security ForceMOU BETWEEN BalmerLawrie& Co. Ltd & Controller General of Defence Accountsmou between Kamarajar Port Ltd. & Toyota Kirloskar motor PvtMr. H.H. Moran Mor Ignatius Aphrem IIMridaparikshak Lab (for Soil Analysis) at Indian Council of Agricultural ResearchMridula SinhaMrs. S. Ramsay editor of quarterdeckmsmemsme awardsmsme minister kalraj mishramsme minister of indiaMufti Mohammad SayeedMughal Gardens of Rashtrapati BhavanMukhtar Abbas NaqviMultimodal Manufacturing Project of GEMumbaiMUMBAI NEWSmumbai policemumbai political newsmunicipalities of various states of indiaMurli Deora ckowkMysoremysore newsN SRINIVISANN. RangaswamyN.N. VohraNarendra Modi having 'Walk the Talk' with the US PresidentNarendra Modi in ‘One on One’ Talks on the tea with the US PresidentNariman Point MumbaiNation-Wide inaugural ceremony of Value Education organised by Ramakrishna MissionNational Awards for the Best Electoral Practicesnational book trustnational book trust of indiaNational Bravery Award winnersNational Bravery Award winners 2014National Bravery Award-2015 winner childrenNational Bravery Award-2015 winner children with vice president of indiaNational Conference on Animal Taxonomy–Challenges and ProspectsNational Conference on Animal Taxonomy–Challenges and Prospects organised by Zoological Survey of IndiaNational Conference on Development & Export of SpicesNational Conference on Strengthening the Economy through Judicial Reformsnational congress partyNational Disaster Response ForceNational Meet on Adoptionnational school of dramanational security guardNational Skill Development Corporationnational stock exchangeNational Tiger Conservation AuthorityNational Voters’ DayNational youth Daynationalised banks of indianavratnasnavratnas listNCCncc cadetsncc dgncc newsncc rallyNCC Republic Day Parade CampNCC Republic Day Parade Camp 2015ncpncp partyncpcrndmcndrfndtvnetasnetas of indiaNetworkingNew DelhiNEW DELHI NEWSnew Member Mechanicalnewsnews about indianews about states of indianews of different states of indianews of indianews of psu’s of indiaNEWS ON WATER SUPPLIERS OF DELHInews online latest news in ENGLISHnews todayNews Updatenews website latest NEWS photos videos news breaking news in ENGLISHnews websitesNGO IN INDIANGOsNicola GruevskinimhansNirmala SitharamanNISGniti ayogNobel Peace LaureateNoida Shaheed Smarak.Nokianokia newsnorth block of rashtrapati bahavanNorth Eastern Region MSMEs Conclave 2015northern railwaysnorthern railways newsNRDCnrinsdnsense mumbainse quotesnsgNSS VolunteersNTPCntpc cmdNTPC K BISWALntpc ladies clubntpc ladies club newsntpc newsO.P. Kohliofficial directory of government of indiaOil & Gas Conservation FortnightOil & Gas Conservation Fortnight-2015oil psuOkram Ibobi SinghOliver-BaeteOm Prakash Dhankaromar abdullahOommen Chandyorganised by the eminent artist Manav GuptaP. RadhakrishnanP.C. Agarwal Secretary HKNSP.V. RajagopalPacific Fleet US NavyPanchayati RajparliamentParliament HouseParliament newsparliament of indiaparliament of india newsParliamentariansParliamentarypassportpassport applicationPATNA NEWSPaul PolmanPay CommisionPCSPedro Morenes EulatePenny PritzkerPeoplePersonnelPETROLEUM MINISTRYpgcilphone directoryphone number of indian govtphone numbers of government of indiaphone numbers of indian government employeesPinaka 214 MM Multiple Barrel Rocket Launcher SystemPiyush GoyalPlenary Session III of Youth Pravasi Bharatiya Divas 2015PMNRFPMO Mobile App developmentpnbPNB DOCUMENTARY FILMPNB DOCUMENTARY FILM VARDAANpnb ed gauri shankarPNB EXECUTIVE DIRECTORPNB PrernaPNB supported Hind Kusht Nivaran Sangh for leprosy eradicationpoland newsPOLICE COMMISSIONER B S BASSIpolice commissionerspolice commissioners listPoliciesPolicyPOLIO DROPSpolio in indiapoliticalpolitical newspolitical news of indiapolitical parties in indiapolitical sitespolitical websites of indiapoliticspolitics newsPopulationport blairport blair newsposcopower gridPower Grid Corporation of India Limitedpower persona of the year awardspower psupower psu newsPower Solutionspowerful bureaucrats of indiaPrakash MishraPravasi Bharatiya DivasPravasi Bharatiya Divas 2015Pravasi Bharatiya Samman Awardspremier banks of indiapresident assochampresident ficciPresident Gorkha Brigade and Colonel of the Regiment 5 Gorkha Riflespresident of india administering polio dropsPresident of World BankPresident's EstatePress Information Bureauprime minister national relief fundPrime Minister of Bhutanprime minister of indiaprime minister of polandPrime Minister's NCC RallyPrime Minister's Officeproducer Dinesh VijanProf. (Dr.) Ram Shankar KatheriaProf. Anjan Ananda SenProf. Kaptan Singh SolankiProf. Mohammad MiyanProf. Ram ShindeProf. Sanjay JhinganProf. Ved PrakashProf. Vijay K. ChaudharyProfessor of Head Department of BiochemistryPSupsu chairmans listpsu ntpcPSU of indiapsu updatePublic Grievances & PensionsPublic Healthpublic relation officers of PSUpublic sector undertakings of indiapulse poliopunab national bankPune DGAFMS Lt. Gen BK. ChopraPunjab National BankQuarterdeck bookQUARTERLY FINANCIAL RESULTS OF NATIONALISED BANKS OF INDIAR.K. MathurR.K. Tyagi former hal chairmanR.S. SharmaR.V. College of EngineeringRaahgiri Day for Persons with DisabilitiesRaahgiri Day for Persons with Disabilities in delhiRadha Mohan Singhrahul gandhiRail Bhavanrail bhawanRailway BoardRailway Board & Ex-officio Secretary to the Government of Indiarailway board membersrailway budgetrailway budget newsrailway ministryrailways newsRaipurRajasthanRajasthan Directoraterajasthan government newsrajasthan Suratgarh Military StationRajeev KherRajendra RathoreRajesh Agarwalrajiv gandhiRajiv Pratap RudyRajive Kumarrajnath singhRaksha Mantri Padakram naresh yadavram vilas paswanRamakrishna MissionRan of KachchRao Inderjit SinghRaosaheb Dadarao DanveRashtrapati Bhavanrashtrapati bhavan newsrationalravi shankar prasadravindra singhRBIRedesigned Websites of the Ministry of PowerRegulationsrenowned scientists of indiaREPUBLIC DAYRepublic day newsrepublic day of indiarepublic day tableau of the Ministry of Indian RailwaysRepublic of South AfricaREPUTED FASHION DESIGNERS IN INDIAreserve bank of indiaResource centerreutersRICHARD RAHUL VERMARiver Development and Ganga RejuvenationRoad Safety and Safe Mobility InitiativesROAD SAFETY WEEKROBERT VADRArpfrs chief mohan bhagwat controversial statement on Mother teresarss chiefruling powerRural and Maritime DevelopmentRural DevelopmentS. Iswaransacred bodhi plantSadhvi PrachiSalma Ansarisalman khansamacharnewssamadhi of mahatma gandhisamajwadi partsamajwadi partysamchar4mediaSankranti MilanSANTANU SAIKIAsantosh kumar gangwarSarbananda Sonowalsarkarisarkari babussarkari babus of indiasarkari bodiessarkari bodies of indiasarkari jobsarkari naukrisarkari newssarkari officialssarkari phonesarkari phone directorysarkari phone numberssarkari resultsarkari websitessarkarimirror.comsarkaritelSaurabh Chandrasaurabh chandra petroleum secretarySBIscientists of indiascope directorySCOPE HR Summit 2015scope hr summit newsscope newsscope telephone directoysebiSecond Session of the UNESCAP Working Group on Asian and Pacific Decade for Persons with DisabilitiesSecretary (Health)secretary amitabh kantsecretary ashok lavasasecretary indiasecretary of indiaSecretary of Ministry of Skill Development and EntrepreneurshipSecretary of Ministry of Skill Development and Entrepreneurship Sunil AroraSectorssecuritysenior Government representatives from 15 countries and 15 Civil Society Organizations in the Asia Pacific RegionSergey NaryshkinSesquicentennial function of Advocates' Association of Western IndiaSHAHRUKH KHANShaikh Khalid Bin Mohamed Al Khalifasharad pawarSharda UniversityShatrughan SinhaShivraj Singh ChouhanShri Anant Kumar SinghShri Arun Jaitley briefing the media about the deliberations of the first meeting of the Governing Council of NIITI Aayog chaired by the Prime MinisterShri Narendra ModiShri Raman SinghShri Rao Inderjit SinghShri Shingaji Thermal Power ProjectSIATSIDELINED BCCI CHIEFsigning of the agreements between Kamarajar Port Ltd. and Toyota Kirloskar motor Pvt. Ltd.Sikh RegimentsingaporeSir Ashutosh Mookerjeesir ganga ram hospitalSir Nicholas Patrick CarterSmall and Medium Enterprisessmriti iraniSneh Lata KumarSocial Justice & EmpowermentSocial MediaSocial securitySoil Health Cardsonia gandhisouth block of rashtrapati bhavanSpanish Defence Ministerspeaker of lok sabhasportssports news top sports newsSri Sri Ravi Shankarsrinagar newsSRKStage I of Shri Shingaji Thermal Power Project to the nation at KhandwastateSTATE BANK OF INDIAState Civil Servicesstate government newsstate government of indiastate governments of indiaStatesStatisticsStatus of Tigers in India 2014stiture Parade of Railway Protection Forcestock exchange of indiaSTYLIST AAMER ZAKIRSudarshan Bhagatsudhir bhargavasunil arorasupreme court of indiaSupreme Head of the Universal Syrian Orthodox ChurchSuratgarh Military StationSuratgarh Military Station in rajasthanSuresh Prabhakar PrabhuSuresh Prabhakar Prabhu launching a ‘Customer Complaint Web Portal and Mobile Application’sushma swarajswachh bharatSwami Shantatmanandaswine flu in Telanganasymbiosissymbiosis universitysymbiosis university puneSymposium on International Automotive TechnologyT. R. ZeliangT. Suvarna Rajutableau of cpwd republic dayTableaux ArtistesTableaux Artistes republic day parade 2015Takehiko NakaoTARUN TEJPALtaxTechnologyTechnoogytehelkaTELANGANA NEWSTelecom Servicestelegram sent by USA to the Indian Constituent Assembly in 1946telephone directory of governmenttelephone directory of government of indiatelephone directory of government officials of indiatex trends fairtex trends fair 2015Thaawar Chand GehlotThe Ambassador of Poland to IndiaThe Ambassador of the Republic of KoreaThe Ambassador-designate of United States of Americathe Calcutta High Court Chief Justicethe Central Adoption Resource Authoritythe Central Board of Excise and CustomsThe Chairmanthe Chairman of State Dumathe Chief Advisor to President of Islamic Republic of Iran and Secretary of Council for Free TradeThe Chief Economic AdviserThe Chief Election CommissionerThe Chief Minister of Biharthe Chief Minister of ChhattisgarhThe Chief Minister of DelhiThe Chief Minister of GujaratThe Chief Minister of HaryanaThe Chief Minister of Himachal Pradeshthe Chief Minister of Madhya PradeshThe Chief Minister of MaharashtraThe Chief Minister of ManipurThe Chief Minister of NagalandThe Chief Minister of PuducherryThe Chief Minister of RajasthanThe Chief Minister of TripuraThe Chief Minister of Uttar PradeshThe Chief of Army Staffthe Chief of Gen. Staffthe Chief of Naval Staffthe Commerce MinisterThe Commerce SecretaryThe Defence SecretaryThe DG NCCThe Director General AADthe Director General Coast GuardThe Director of the International Department of the Central Committee of the Communist Party of Chinathe election commissionerthe ENDOLAP 2014- Third Biennial International Conference and Advanced Live Laparoscopic WorkshopThe Finance Minister of Republic of Turkeythe Foreign Minister of BahrainThe former Chief Minister of J & KThe former Director of Indian Institute of ScienceThe former PresidentThe former President of MaldivesThe French Defence Ministerthe General & Census CommissionerThe Global CEOThe Governor of GoaThe Governor of Gujaratthe Governor of Haryanathe Governor of Jammu and Kashmirthe Governor of KarnatakaThe Governor of Madhya Pradeshthe Governor of West Bengalthe Health Ministerthe highest gallantry award Ashok ChakraThe Indian Boxerthe Indian Constituent Assemblythe Indian Machine Tool Manufacturer’s Associationthe International Mother Language DayThe Jr. Commanderthe Krantiguru Shyamji Krishna Verma Kachchh Universitythe launch of the National Deworming initiativeThe Lt. Governor of Andaman & Nicobar Islandsthe Minister for Agriculturethe Minister for Minority Affairs of Maharashtrathe Minister of CultureThe Minister of Defence and General of Army of Russia Sergey K. Shoyguthe Minister of EducationThe Minister of Foreign Affairs of JapanThe Minister of Health and Medical Services of Fijithe Minister of Industry and Tradethe Minister of Industry and Trade Czech Republic Jan MladekThe Minister of International Relations and CooperationThe Minister of Labour of CanadaThe Minister of State (Independent Charge) for Powerthe Minister of State for Chemicals & FertilizersThe Minister of State for Commerce & IndustryThe Minister of State for Consumer AffairsThe Minister of State for Culture (Independent Charge)The Minister of State for FinanceThe Minister of State for Heavy Industries & Public EnterprisesThe Minister of State for Home (Rural)The Minister of State for Home Affairsthe Minister of State for Human Resource DevelopmentThe Minister of State for Information & Broadcastingthe Minister of State for Labour and EmploymentThe Minister of State for Labour and Employment (Independent Charge)The Minister of State for Micro Small & Medium EnterprisesThe Minister of State for Minority Affairs and Parliamentary AffairsThe Minister of State for Petroleum and Natural GasThe Minister of State for Petroleum and Natural Gas (Independent Charge)The Minister of State for Planning (Independent Charge) and DefenceThe Minister of State for Railwaysthe Minister of State for Road Transport & Highways and ShippingThe Minister of State for Rural DevelopmentThe Minister of State for Science and Technology and Earth ScienceThe Minister of State for Skill Development & Entrepreneurship and parliamentary affairsthe Minister of State for Social Justice & Empowermentthe Minister of State for Statistics and Programme Implementation (I/C)The Minister of State for Urban Developmentthe National Deworming initiativethe National Librarythe National Science Day Lecture on “Science for Nation Buildingthe North Eastern Region MSMEs Conclave 2015The Parliamentary State SecretaryThe Peranakan World - Cross Cultural Art from Singapore and the Malacca Straitsthe presentation of Standards to 21 SQN & 116 HU of Indian Air ForceThe President Asian Development BankThe President of the Association of Biotechnology Led EnterprisesThe President of the Democratic Socialist Republic of Sri Lankathe President of the Republic of SingaporeThe Prime Minister of Macedoniathe Railway Budget 2015-16the Raksha Mantri’s Trophythe Second Minister for Trade & Industry of SingaporeThe Secretarythe Secretary (BM)The Secretary Ministry of Culture Ravindra SinghThe Secretary Ministry of TourismThe Secretary Ministry of Tribal Affairsthe Secretary of Delhi Ramakrishna MissionThe Spanish Defence Ministerthe State Level Khadi Gramodyog Exhibitionthe State Level Khadi Gramodyog Exhibition in guwahatiThe tableau of GoaThe tableau of Goa on rajpathThe tableau of Goa on rajpath on republic dayThe tableau of Indian NavyThe tableau of KarnatakaThe tableau of Maharashtrathe tableau of ministry of railwaysThe tableau of the Department of Financial ServicesThe tableau of the Department of Financial Services at republic dayThe tableau of the Ministry of Indian RailwaysThe tableau of the Ministry of Indian Railways on rajpathThe Tennis PlayersThe UGC ChairmanThe Union Minister for AgricultureThe Union Minister for Agriculture senior officials of ICARThe Union Minister for Chemicals and FertilizersThe Union Minister for Civil AviationThe Union Minister for Communications & Information TechnologyThe Union Minister for Defencethe Union Minister for External Affairs and Overseas Indian Affairsthe Union Minister for FinanceThe Union Minister for Health & Family WelfareThe Union Minister for Heavy Industries and Public EnterprisesThe Union Minister for Human Resource DevelopmentThe Union Minister for Law & JusticeThe Union Minister for MicroThe Union Minister for Minority AffairsThe Union Minister for RailwaysThe Union Minister for Road Transport & Highways and ShippingThe Union Minister for Rural DevelopmentThe Union Minister for Social Justice and EmpowermentThe Union Minister for Tribal AffairsThe Union Minister for Urban DevelopmentThe Union Minister for Water ResourcesThe Union Minister for Women and Child DevelopmentThe US PresidentThe Vice Chairmanthe Vice Chancellor of Maulana Azad National Urdu University (MANUU)the Vice President of the Asian Development Bankthe Voters’ Day Pledge at Kamla Nehru Collegethinkedu conclaveThird Biennial International Conference and Advanced Live Laparoscopic WorkshopThiruvalluvar Daytimes of indiatimes of india epaperTofail Ahmedtokyo newsTomasz Lukaszuktop 10 news websites of indiatop 10 websites of indiatop banks of indiatop bureaucracy websitestop bureaucrats of indiatop defence newstop defence news websites of indiatop educational institutestop english news websitesTOP FASHION NEWS OF INDIAtop global newstop governance websitestop government newstop government news websitestop government news websites of indiatop indian political newstop indian political news websitestop international newstop news of indiatop news storiestop news websitestop news websites of indiatop political newstop political news in indiaTOP POLITICAL NEWS WEBSITEStop political sitestop political web sitestop political websitestop psu newstop ten news websites in the worldtop ten news websites of asiatop ten news websites of indiatop ten websites of indiaTourism (Independent Charge) and Civil AviationTourism and Marketing of MaharashtraToyota Kirloskar motor Pvt. Ltd.Trade &transportationtribal food festivalTshering TobgayTughlakabadtwo-day National Thematic Workshop on the ‘Best Practices for Women and Child Development’UdyanotsavUdyanotsav of mughal gardenUKuk defence newsUNUN Genral SecretaryUNAUDITED FINANCIAL RESULTS OF NATIONALISED BANKS OF INDIAUNDERGROUND RESERVOIRS OF DELHI JAL BOARDUNESCAPUnileverUnion Home Ministerunion minister for raiwaysUnion Minister for Road Transport & Highways and Shippingunited kingdom defence newsunited nationsunited nations general secretaryUniversity of Delhiuniversity of lucknowuniversity of lucknow convocationUPUP CMup cm akhilesh yadavUPA MINISTER KRISHNA TIRATHupdated government newsupdated newsUpendra KushwahaUrban Auxiliary Nurse Midwifeus ambassador to indiaus president arack Obama inspecting the Guard of Honourus president barack obamaus president during india visitUS Secretary of CommerceUS Secretary of StateUTUtilitiesUTsUwe BackmeyerVajubhai RudabhaiValedictory Session of the Pravasi Bharatiya Divas 2015VARDAAN DOCUMNTARY FILMvarun dhawanVasundhara Raje Scindiavibrant gujaratVibrant Gujarat Global SummitVice Admiral Anurag G. Thapliyalview of the illuminated Rashtrapati BhavanVijay SamplaVinayak Shah Marge & Dorabi Tata MargeVirbhadra SinghVisaVision 4G-India’s next Telecom Revolutionvisitor’s book at the Amar Jawan Jyotivoter id applicationvoter id cardvoters card list of indiaVOTERS DAYWang Jiaruiwater newsWencai ZhangWest Zone Cultural CentreWest Zone Cultural Centre Udaipurwhats happening in indiaWHITE DESERTwho is delhi chief ministerWHO IS THE CURRENT MD OF PUNJAB NATIONAL BANKWHO IS THE EXECUTIVE DIRECTOR OF PNBwife of vice president of indiaWildlife Crime Monitoring SystemsWinners of the National Bravery Awards-2014Wirelessworkshop on ‘Performance Evaluation and Management of State Owned Enterprisesworkshop on National Aviation Universityworkshop on Streamlining Government CommunicationWorkshopsworld best political newsworld best political news websiteworld best political news websitesworld breaking newsworld embassies indiaworld government newsWorld Leprosy Dayworld newsWorld Toilet Summit 2015Y.S. Chowdaryyair shamirYakovlevs - a four aircraft display team from UKYami GautamYelahankazeenewsZoological Survey of Indiazsi
The President, Shri Pranab Mukherjee with the recipient of the 8th National Biennial Awards for..
Events

The President, Shri Pranab Mukherjee with the recipient of the 8th National Biennial Awards for..

sarkarimirror March 7, 2015

The President, Shri Pranab Mukherjee with the recipient of the 8th National Biennial Awards for Grassroots Innovations and outstanding Traditional Knowledge, at Rashtrapati Bhavan, in New Delhi on March 07, … Read More

. The Minister of State for Road Transport & Highways and Shipping P. Radhakrishnan‘National conference on Strengthening of Cooperative - Education and Training system“Beti Bachao14th World Toilet Summit 2015150th birth anniversary celebrations of Sir Ashutosh Mookerjee15th International Seminar on “Counter IED Strategy15th International Seminar on “Counter IED Strategy by nsg19th convocation Ceremony of NIMHANS2013-2022 in New Delhi2015. The Vice Chairmen of NITI Aayog20th Meeting of the Central Zonal Council21st International Conference & Exhibition on Terrestrial and Satellite Broadcasting24th Admiral R.D. Katari Memorial lecture29th Arunachal Statehood Day29th Arunachal Statehood Day function29th meeting of the Central Consumer Protection Council400kV GIS sub-station44th Battalion Rashtriya Rifles4th India International Potato Expo-201553rd Annual Session of Cement Manufacturers’ Association66th republic day celebration of india66th Republic Day of india67th army day7th Vibrant Gujarat Global Summit 20158th National Biennial Awards for Grassroots Innovations and outstanding Traditional KnowledgeA. SethumadhavanA. Sethumadhavan chairman of national book trust of indiaA.K. MitalaajtakAAM AADMI PARTYAAMER ZAKIRAAMER ZAKIR INTERVIEW IN SARKARIMIRRORAAMER ZAKIR INTERVIEW WITH TARUN SHARMAAAMER ZAKIR INTERVIEWSAAMIR KHANaapAAP LEADER ASHUTOSHAcute Encephalitis SyndromeAdditional Member (Commercial) Railway BoardAdditional Secretary (Centre-State)Addl Secy. (Health)Adi Sankara’sAdi Sankara’s lifeAdmiral Harry HarrisAdmiral R.D. KatariAdmiral R.K. DhowanAdvocates' Association of Western IndiaAero India-2015Aero India-2015 Air ShowAESafr of psuAGMagm of psuagricukture newsagricultureAgriculture Minister of Israelagriculture newsaiccaicc chiefAir Chief Marshal Arup RahaAir Marshal J.S. Klerairline operators in indiaairlines in indiaAjay ShuklaAkbar Torkanakhilesh yadavAll India Citizens’ Alliance for Progress & DevelopmentALL INDIA CRIME NEWSAll India Federation of the Deaf’All India Federation of the Deaf’ PresidentAll India Federation of the Deaf’ President Kum. Surrender SainiAll India Shwetamber Sthanakvasi Jain ConferenceAll India Shwetamber Sthanakvasi Jain Conference presidentAll India Shwetamber Sthanakvasi Jain Conference spiritual mahakubh indoreAll India Shwetamber Sthanakvasi Jain Conference spiritual mahakumbhAmar Jawan JyotiAmbassador of China to Indiaambassadorsambassadors of indiaambassadors of various contries in indiaambassadors to indiaambassadors to india from across the globeamitabh kantAmitabh Kant secretaryanandiben patelanant GeeteAnanthkumarAnil SwarupANMAnti LeprosyAnti Leprosy dayAnti Leprosy FortnightAnti Leprosy weekApplicationsarack Obama inspecting the Guard of Honour during india visitarmuy daiAROON PURIEarun jaitleyArunachal Statehood DayArundhati Bhattacharyaarvind kejiwalarvind kejriwal delhi chief ministerArvind Panagariyaashok chakraAshok Gajapathi Raju PusapatiAshok LavasaASHUTOSHasia newsasian development bankASSOCHAMAssociate professor Department of biochemistryAssociation of Chambers of Commerce& Industries in IndiaAt Home` reception of US President Barack obama in new delhi oon 66th india republic dayat the inauguration of the DGNCC Republic Day Camp 2015at the World Book Fairat the World Book Fair-2015AUDITED FINANCIAL RESULTS OF NATIONALISED BANKS OF INDIAaustralian senatorautonomous bodies of indiaaviation newsB S BASSIB.P. SharmaBabul Supriyobabusbabus of indiaBAE Systemsbahrain newsbahujan samaj partyBalmerLawrie& Co. LtdBan Ki-moonBand performing at the Beating the Retreat CeremonyBand performing at the Beating the Retreat Ceremony at rashtrapati bhavanBandaru DattatreyaBangaloreBank MitrBANKSbanks in indiaBarack Obamabarack obama india visit on republic dayBarack Obama paying floral tributes at the Samadhi of Mahatma Gandhibaramati newsbasic needsbbcBC AGENTSBCCI CHIEFbeating retreatbenefits the societyBengal Global Business SummitBES EXPO-2015BEST BANKS OF INDIAbest diplomacy newsbest diplomacy websitesBEST DOCTORS OF SIR GANGA RAM HOSPITALbest entertainment newsbest news of indiabest news websitesbest political sitesbest political websitesbest political websites of indiabest Road Safety PracticesBeti hai to kal haiBeti Padhao logoBHARAT ELECTRONICS LTD.Bharat Rang MahotsavBharat Rang Mahotsav organised by National school of dramaBhuj newsBhupendrasinh M. Chudasamabhutan newsBicentenary Celebrations of Gorkha Riflesbimal julkaBimal Julka inaugurating the Display of Publications Division’s books at the World Book Fair-2015Birth Anniversary Celebration of Swami VivekanandbjpBJP PRESIDENTboard members of indian railwaysbodhi plantbollywood newsBollywood starsbombay high court museum officialsBook of the Institute of Indian LanguagesBook of the Institute of Indian Languages Mysorebook on Adi Sankara’s lifebook on Adi Sankara’s life and teachinsbook Quarterdeckbook release India–2015 Reference Annualbooks by northern railwaysbooks published by northern railwaysborder haatborder hatt at srinagarBorder Security ForceBranding ideasbreaking newsbreaking news of indiaBRICS International Youth Forum 2015britains BAE Systems for Indian Air ForceBSEbse quotesbspbudget session of parliament of india 2015bureaucracybureaucracy todaybureaucracy today in indiabureaucratsbureaucrats in indian politicsBUREAUCRATS NEWSbureaucrats of indiaBusinessbusiness entertainment news in ENGLISH about india local news onlinebusinessworldC.K. Mishracabinet ministers of indiaCadet Sergeant Shubham Bairagicadets from Jammu & KashmircaraCENSER BOARD CHIEFCENSOR BOARD OF INDIACentenary Celebrations of by Zoological Survey of IndiaCentenary Celebrations of ZSIcentral government directorycentral government newscentral government of indiaCENTRAL RAILSIDE WAREHOUSING CORPORATION LTD.CEO DELHI JAL BOARDCEO DJBceo helpage indiaCEO OF DELHI JAL BOARDceo poscoCEO-Designate Allianz Group of GermanyChairman and Managing Director of National Research Development Corporationchairman of hindustan aeronauticals ltdchairman of national book trustchairman of psuchairman of visitbritainCHAIRMAN SPEECH OF GOVERNMENT BANKS OF INDIACHAIRMAN SPEECHES OF BANKS IN INDIAchairmans of psuCHAIRPERSON SBICHANDIGARH NEWSChaudhary Birender Singhchennai newsChhattisgarhCHIEF ELECTION COMMISIIONERchief justice of indiachief manager of psuChief Minister of GujaratChief Minister of HaryanaChief Minister of KeralaChief Minister of Madhya Pradeshchief ministers of indiachief ministers of statesChief of Army Staffchief of the air staff indiachina newsCHRISTIAN COMMUNITY NEWS IN INDIAChristopher Rodriguezcitation for the Best Service Hospital to Command Hospital (SC)Citizen Journalistcivil aviation minister of indiacivil aviation newsclosing ceremony of the National Tribal Festival- 2015 VANAJcm akhilesh yadavcm delhi inaugrates dwarka water treatment plantCMDcmd air indiacmd bhelcmd bsnlcmd delhi tourismcmd ficcicmd gailcmd hudcocmd irconcmd irctccmd licCMD MTNLcmd nalcocmd national insurancecmd nhpcCMD NRDCcmd ntpccmd obcCMD of Biocon Limitedcmd of indian psucmd of psucmd of psu of indiacmd ongccmd oriental bankcmd pnbCMD POSCO INDIAcmd powerfinancecmd powergridCMD Punjab & Sind Bankcmd railtelcmd reccmd ritescmd sailcmd scicmd sidbicnbcCNN IBN EDITOR ASHUTOSHCoal and New & Renewable EnergyCoal and New and Renewable EnergyCoal and New and Renewable Energy the Minister of State (Independent Charge) for PowerCoal and NRECol. Rajyavardhan SinghCol. Rajyavardhan Singh RathorecolumnCOMEDIAN KAPIL SHARMAComedy Nights With Kapil.CommerceCommunicationsComputerconference on pahalcongresscongress partyConnectivityCONSTABLE AJMERSINGHConstitutionconsulate of indiaConsultative Workshop on Urban GovernanceContest for PMO Mobile App developmentController General of Defence AccountsCorporate Affairs and Information & BroadcastingCosmology and Astrophysics Research Group Centre for Theoretical Physicscpwdcpwd newscpwd tableau at rajpath on republic dayCRIME NEWScurremnt newcurrent affairscurrent affirscurrent chairman of hindustan aeronauticals ltdcurrent cmd of ntpccurrent newscurrent speaker of lok sabhaCzech RepublicD.V. Sadanandadare devil stunts of motorbike riders of Border Security ForceDASDatacentersdefence newsdefence personnels of indiaDefence Researchdefence websites of indiadefenseDelhi Administration Subordinate Service Cadredelhi assemblydelhi assembly elction newsdelhi assembly elections 2015delhi assembly elections latest newsDELHI CHIEF MINISTERdelhi crime newsdelhi deputy chief ministerdelhi economic surveydelhi governmentdelhi government newsdelhi jal boarddelhi jal board ceoDELHI JAL BOARD CHAIRPERSONDELHI JAL BOARD DWARKA WATER TREATMENT PLANTDELHI JAL BOARD HEAD OFFICEdelhi jal board newsDELHI NEWSdelhi policedelhi police commissionerDELHI POLICE EAST DELHIdelhi police head quarterdelhi police head quartersDELHI POLICE SPECIAL STAFFDELHI POLLSDELHI POLLS DATEDELHI TRANSPORT ROAD SAFETY WEEKDELHI TRASPORT NEWSDELHI WATER SUPPLIERSdeli police newsDepartment of Atomic EnergyDepartment of Electronics and Information TechnologyDepartment of Empowerment of Persons with DisabilitiesDepartment of Financial ServicesDepartment of Industrial Policy and PromotionDepartment of Spacedeputy chief minister of delhiDeputy Prime Minister of PolandDevelopment and Technology CooperationDevendra FadnavisDGDG (Inspection & Safety)dg J. N. Chakarvatidg nccDG NCC Republic Day Camp 2015dg nsgDGNCC Republic Day Camp 2015Dharmendra Pradhandiplomacy websitesdiplomacy websites in indiaDirector GeneralDirector General (M&C)directory of central governmentdirectory of embassies consulates in indiadirectory of government of india officialDisaster ManagementDiscussion boardDistrictsDivya Singh Deo GajapatiDJB introduces Online Complaint Registration and Status Check Facility for its consumersDoordarshandr m ravikantDr. A.P.J. Abdul KalamDr. Amita GuptaDr. Arup Roy ChoudhuryDr. Arvind SubramanianDr. C. ChandramouliDr. H. PandaDr. Hanumanthu PurushothamDr. Jitendra SinghDr. K.K. PaulDr. Kellie LeitchDr. Lalit K. PanwarDr. Mahesh SharmaDr. Najma A. HeptullaDr. P. BalaramDr. P. C. KokilaDr. Rajendra Prasad Sarvodaya VidyalayaDr. Rakesh KumarDr. Raman SinghDr. Syed Nasim Ahmad ZaidiDr. Tony Tan Keng YamDr.RAM .S.SANGAPUREDrinking Water and Sanitatione governanceE-book of Ministry of EnvironmentEconomic Growtheconomic surveysEconomicsED GAURI SHANKAREducationeducational institutes in greater noidaeIndiaEknath Khadseelection commisiionELECTION COMMISSIONELECTION COMMISSION OF INDIAelections model code of conductElectoral Roll databaseembassies abroad indiaembassies in delhiembassies in indiaembassies of indiaENGLISH newsENTERTAINMENT NEWSEnviornmentEnvironmenterickshawserickshaws association in delhierickshaws in delhiesic chennaiethiraj college for womeneurope newseuropre newsEXCHANGE4MEDIAExecutive Director PUNJAB NATIONAL BANKExternal Affairs and Overseas Indian Affairsfarmers newsFarmers RallyFarmers Rally at baramatiFASHION DESIGNER AAMER ZAKIRfashion designers in indiafather of nation mahatma gandhiFederal Assembly of Russian FederationFICCIFijiFINANCEfinance newsfinancial institutes in indiaFINANCIAL RESULTS OF BANKSFirst Lady Michelle ObamaFirst Visitors Award-2015 for the Research 2015flying Russian origin Yak aircraftFood and Public Distributionforeign ambassadors in indiaforeign embassies and consulates in indiaForest and Climate ChangeForests and Climate ChangeFORMER JOURNALIST SANTANU SAIKIAfoundation day of NCPCRFoundation Stone laying Ceremony of the Centre of Excellence for Vegetable Development in BaramatiFoundation Stone laying Ceremony of the Centre of Excellence for Vegetable Development in Baramati by prime minister of indiaFrench Defence Ministerfull dress rehearsal for the Republic Day Parade-2015Fumio KishidaG.M. Siddeshwaragallantry award Ashok ChakraGandhigandhi familyGandhi Peace FoundationGandhi SmritiGANDHINAGARGANDHINAGAR NEWSgauri shankarGee Woong SungGeneral (Retd.) V.K. SinghGeneral Budget 2015-16General Dalbir SinghGENERAL KNOWLEDGEGeneral Managers PR of psuGeneral Zhang YouxiaGermanygermany newsgfilesindiagiriraj singhGISGLOBAL NEWSglobal news websitesgm of psugoernment of jaipurGoIgoi officialsGolden Jubilee Celebrations of R.V. College of Engineeringgorkha riflesgovernancegovernance newsgovernance nowGoverning Council of NIITI Aayoggovernment contact directorygovernment contact listgovernment contactsgovernment directorygovernment jobsGOVERNMENT JOBS IN INDIAGovernment Law CollegeGovernment Law College Mumbaigovernment newsgovernment news indiagovernment news of indiaGOVERNMENT OF DELHI NEWSGOVERNMENT OF GUJARATgovernment of indiaGovernment of india contact numbersgovernment of india newsgovernment of india news todaygovernment of india official contactgovernment of india official contact detailsgovernment of india official contact numbersgovernment of india official contactsGOVERNMENT OF INDIA OFFICIALSgovernment of india officials newsgovernment of india telephone directorygovernment of india websitesGovernment of Madhya PradeshGOVERNMENT OF NCT OF DELHIGovernment of RajasthanGovernment of the People's Republic of Bangladeshgovernment phone directorygovernment psu of indiaGOVERNMENT PSU OF INDIA NEWSgovernment telephonegovernment telephone directorygovernment telephone numbersgovernment tendersgovernnanceGovernor of UttarakhandGovt IssuesGuard of Honour during the presentation of Standards to 21 SQN & 116 HU of Indian Air Force in Jodhpurgujaratgujarat newsGujarati Association malaysiaGujarati AssociationsGujarati translation of ThirukkuralH.S. BramhaHALhal bangalorehamid ansarihamid ansari office addressHansraj Gangaram Ahirhappening news of indiaHaribhai Parathibhai ChaudharyHARISHANKAR BRAHMAHAWK MK 132 simulatorhe Minister of State for Development of North Eastern RegionHead of General Armament Department of the PLA and the member of CMChead quarters of delhi policeheadlines in cricketheadlinestodayHeads of Mission Conferenceheads of psu of indiahealth issueshealth newsHealth Sustainabilityhelpage indiaHelpline for Drug De-AddictionheritageHeritage City Development and Augmentation Yojanahigh commission in delhihigh commission in new delhihighlights of union budgetHIGHLIGHTS OF UNION BUDGET 2015Hight CourtHind Kusht Nivaran Sanghhindustan aeronauticals ltdhindustan aeronauticals ltd chairmanHindustan Aeronautics LimitedHindustan Aeronautics Ltdhindustan timeshindustan times epaperhome minister of indiahome secretary L.C. Goyal.who is the home secretary of indiahorticulturehorticulture newshorticulture updtaeshospitalsHotel TridentHousing and Urban Poverty AlleviationHousing and Urban Poverty Alleviation and Parliamentary AffairsHRIDAYHTT-40 trainerhuco newsHUDCOhudco bhawan at new delhihudco bhawan at salt lakeHUDCO CMDHUDCO NEWShudco office in new delhiHuman RightsHYDERABAD NEWSIAASiafIAF Republic Day Parade 2015 marching contingentiariIASias dr m ravikantIAS HARISHANKAR BRAHMAIAS OFFICERSias officers of indiaias preparationsIBAIBA BANKING TECHNOLOGY AWARDibn7ibn7 nwsibnliveIESIFoSifsiisimphal newsIMTEX and Tooltech-2015in New Delhiin New Delhi on February 08inadian army newsinaugration of delhi jal board water treatment plant by arvind kejriwalinaugration of India Water Week 2015inaugration of Multimodal Manufacturing Project of GEinaugration of Multimodal Manufacturing Project of GE by narendra modiinaugural ceremony of the 63rd All India Police Wrestling Cluster 2014-15inaugural ceremony of the 63rd All India Police Wrestling Cluster 2014-15 organised by itbpinaugural session of the 14th World Toilet Summit 2015inauguration of the 7th Vibrant Gujarat Global Summit 2015inauguration of the AIR Chennai’s broadcast of Vividh Bharati on FM channelinauguration of the National Meet on Adoptioninauguration of the New Railway Line between Hazaribag and Kodarma in Jharkhandinauguration of the Oil & Gas Conservation Fortnight of PCRA 2015inauguration of the Public Art Innovation on sustainability “Ganga Waterfront”INCOME TAXincome tax commissionerincome tax departmentincome tax department of indiaincredible indiaindiaindia 7th Agricultural Summitindia air chiefindia best bureaucracy websiteindia best english news websitesindia best news websitesindia best political newsindia best political news websiteIndia Breaking Newsindia bureaucratsINDIA CENSOR BOARDindia chief justiceINDIA CHRISTIAN COMMUNITY NEWSindia civil aviation ministerindia civil aviation newsindia curent affairsindia current affairindia current affairsindia defence newsindia election newsindia fashion newsIndia Gateindia general newsindia home ministerindia horticulture newsindia ias officersindia international newsIndia International Potato ExpoIndia International Potato Expo-2015india khadi industriesindia latest newsindia list of ias officersindia list of ips officersindia nationalised banksindia netasindia newsindia news websitesindia parliament houseindia parliamentariansindia parliamnet newsindia police commissionersindia political newsINDIA POLITICAL PARTIESindia prominent scientistsindia railways tableau at 66th republic dayINDIA REPUBLIC DAYindia republic day beating retreatindia republic day newsindia resultsgovernment jobsindia sarkari babusindia sarkari newsindia Sikh Regimentindia space research organisationindia state governmentsindia todayindia top banksindia top bureaucratsindia top government news websitesindia top n ewsindia top newsindia top news websitesindia top political sitesindia top psu newsINDIA TOP TEN BANKSindia top ten news websitesindia updated newsindia vice presidentindia votersIndia Water Week 2015India-US Strategic DialogueIndia–2015 Reference AnnualIndia–2015 Reference Annual book releaseIndia’s new visa shift and synergies between Britain and Indiaindia’s top 10 bureaucratsINDIAN ADMINISTRATIVE SERVICESIndian Agricultural Research Instituteindian air forceindian air force newsindian ambassador to the united statesINDIAN AMBASSADORSindian armyindian babusINDIAN BANKING ASSOCIATIONINDIAN BUREAUCRACTSindian bureaucracyindian bureaucrats blogINDIAN BUREAUCRATS LISTIndian Coal Story – Prospects and Challengesindian defence newsindian diplomacyINDIAN DIPLOMATSindian diplomats contact numberindian diplomats newsIndian Economyindian embassyindian financial instituesindian governanceindian governance top news websitesindian governmentindian government contactindian government contact detailsindian government contact numbersindian government dirctoryindian government home secretaryindian government newsindian government official websiteindian government phone directoryindian government websitesindian ias officersindian militaryindian military newsindian national congress partyINDIAN NAVRATNASindian ngoindian nri newsINDIAN POLICE SERVICESIndian political newsindian politicsindian politics newsINDIAN PREMIER LEAGUEIndian PSUindian psu headsindian railway boardindian railway board membersindian railway budgetindian railway budget 2015indian railwaysindian railways newsindian railways officialsindian states newsindiatodayindira gandhiIndo Tibetan Border Police ForceINDO-US RELATIONSHIPIndustrial and SEZsIndustriesInformation TechnologyinfrastructureInia Batikoto SeruiratuInstitution of Permanent Way EngineersintegratedINTELECT-2015 & UPTO 11kv exhibitionINTELECT-2015 & UPTO 11kv international exhibitionIntermediate Jet TrainerInternational Customs Day 2015international government newsinternational Gujarati Associationsinternational newsinternational news websitesInteroperableINTERVIEWS OF TOP FASHION DESIGNERS OF INDIAInveInvestiture Ceremony 2015IPLIPSipweipwe indiairsISROisro chiefITit minister of indiait ministryitbpitbp newsITSJ. N. ChakarvatiJ. N. Chakarvati dgJagat Prakash NaddaJaguar Darin-IIIjaipur newsJamia Milia IslamiaJammu and Kashmir newsJammu UniversityJan MladekJanusz Piechocinskijapan newsJapanese EncephalitisJayant SinhaJayanthi SirisenaJEJean Yves Le DrianJHARKHAND NEWSJim Yong KimJitan Ram Manjhijohn kerryJoint SecretaryJoint Workshop on Skill Development and EntrepreneurshipJoint Workshop on Skill Development and Entrepreneurship in new delhiJone UsamteJoon-Gyu LeeJS (RMNCH+A)Jual Oramjual ramK BISWALK U THANKACHANK. RadhakrishnanK.V. Brahmaji RaoKailash Mansarovar Yatra 2015Kailash SatyarthiKalraj MishraKamarajar Port Ltd.Kapil SharmaKAPIL SHARMA COMEDIANKarnataka & GoaKeshari Nath TripathiKhadikhadi gramudyogkhadi industry in indiakhadi newsKiran Kumar Alur SeelinKiran Mazumdar ShawKiren RijijuKMY website & bilingual Interactive Voice Response System (IVRS)kolkata newsKolkata.Krishan PalKrishna TirathKRISHNA TIRATH DALIT LEADERKum. Surrender SainiKwon Oh-JoonL.C. GoyalLALU YADAVlatest amabassadors of indialatest baramati newslatest bureaucrats newslatest bureaucrats of indialatest chairperson of delhi jal boardlatest china newsLATEST CRIME NEWSlatest defence newslatest delhi government newslatest delhi jal board newslatest europe newslatest fashion newslatest finance newslatest government newslatest high commisions in indialatest hudco chairmanLATEST HUDCO CMDlatest hudco newslatest ias officerslatest india newslatest indian railways newslatest internationla newslatest ips officerslatest itbp newslatest jharkhand newslatest military newslatest ncc newsLatest Newslatest news from indialatest news of government of madhya pradeshlatest news of indialatest ntpc newsLATEST PATNA NEWSlatest political newslatest political news indialatest political news of indialatest prime minister of indialatest psu newslatest railway budgetlatest rss newslatest water newslatest world newslatets crime newslatets enws of indialaunch of the “2015 – Year of Active Pharmaceutical Ingredientslaunch of the Venture Capital Fund for Scheduled CastesLawrence WongLe YuchengLEANDER PAESLEELA SAMSONLEELA SAMSON CENSER BOARD CHIEFLeprosy Seal CampaignLight Combat AircraftLight Combat HelicopterLight Utility Helicopterlisa singhlist of ambassadors in indialist of chief ministers of statelist of cmd of india psulist of diplomatic missions of indialist of indian bureaucratslist of top navratnasLord Ian LivingstonLov VermaLt Gen V.K. SaxenaLt. Gen. A. ChakravartyLt. Gen. Aniruddha ChakravartyLt. General (Retd.) Shri A.K. Singhlucknow newsm-Governmentmadhuri dikshitmadhya pradesh chief ministermadhya pradesh newsmadras high courtmadras high court newsMahabodhi templeMaharaja of Purimaharajas of jaipurmaharshtra mla’smahatma gandhimahatma gandhi statuemahatma gandhi statue at gandhinagarMaite Nkoana-MashabaneMaithripala SirisenaMajor Mukund VaradarajanMajor Mukund Varadarajan 44th Battalion Rashtriya RiflesMANAGING DIRECTOR CRWCManeka Sanjay GandhimangalyaanManik Sarkarmanipur newsmanish sisodiaManjula ChellurManohar Lal KhattarManohar ParrikarManoj SinhaMartina HingisMartina Hingis and Leander Paesmartyr's dayMARY KOMMary Tanmatdan mahotsavMathews Cherian ceoMathews Cherian ceo helpage indiaMathribhasha DiwasMathribhasha Diwas celebrationsMaumoon AbdulMCC Chamber of Commerce & IndustryMCC Chamber of Commerce & Industry kolkatamcdmcd commissionermcd newsmeeting of the Central Consumer Protection CouncilMehmetMember of Parliament.Member Trafficmembers of parliament of indiaMHAMilitarymilitary newsminister giriraj singhMinister of State for Culture (Independent Charge)Minister of State for Trade & Investment of UKMinister of State with Independent Charge for Powerministers indiaministers of indiaministries and departmentsministries contact numbersministries of govt. of indiaMINISTRIES OF INDIAministry for developmentMinistry of CoalMinistry of CultureMinistry of FinanceMinistry of Home AffairsMinistry of Information and Broadcastingministry of msmeministry of petroleumMinistry of Petroleum & Natural GasMinistry of PowerMinistry of ShippingMirage upgradeMLAmla’s of indiamodel code of conductmodel polling boothMODI LUNCH AT PARLIAMENT CANTEENMODI TAKING LUNCH AT PARLIAMENT CANTEEN NEWSmohan bhagwat latest newsMOHFWMOTHER TERESAmotorbike riders of Border Security ForceMOU BETWEEN BalmerLawrie& Co. Ltd & Controller General of Defence Accountsmou between Kamarajar Port Ltd. & Toyota Kirloskar motor PvtMr. H.H. Moran Mor Ignatius Aphrem IIMridaparikshak Lab (for Soil Analysis) at Indian Council of Agricultural ResearchMridula SinhaMrs. S. Ramsay editor of quarterdeckmsmemsme awardsmsme minister kalraj mishramsme minister of indiaMufti Mohammad SayeedMughal Gardens of Rashtrapati BhavanMukhtar Abbas NaqviMultimodal Manufacturing Project of GEMumbaiMUMBAI NEWSmumbai policemumbai political newsmunicipalities of various states of indiaMurli Deora ckowkMysoremysore newsN SRINIVISANN. RangaswamyN.N. VohraNarendra Modi having 'Walk the Talk' with the US PresidentNarendra Modi in ‘One on One’ Talks on the tea with the US PresidentNariman Point MumbaiNation-Wide inaugural ceremony of Value Education organised by Ramakrishna MissionNational Awards for the Best Electoral Practicesnational book trustnational book trust of indiaNational Bravery Award winnersNational Bravery Award winners 2014National Bravery Award-2015 winner childrenNational Bravery Award-2015 winner children with vice president of indiaNational Conference on Animal Taxonomy–Challenges and ProspectsNational Conference on Animal Taxonomy–Challenges and Prospects organised by Zoological Survey of IndiaNational Conference on Development & Export of SpicesNational Conference on Strengthening the Economy through Judicial Reformsnational congress partyNational Disaster Response ForceNational Meet on Adoptionnational school of dramanational security guardNational Skill Development Corporationnational stock exchangeNational Tiger Conservation AuthorityNational Voters’ DayNational youth Daynationalised banks of indianavratnasnavratnas listNCCncc cadetsncc dgncc newsncc rallyNCC Republic Day Parade CampNCC Republic Day Parade Camp 2015ncpncp partyncpcrndmcndrfndtvnetasnetas of indiaNetworkingNew DelhiNEW DELHI NEWSnew Member Mechanicalnewsnews about indianews about states of indianews of different states of indianews of indianews of psu’s of indiaNEWS ON WATER SUPPLIERS OF DELHInews online latest news in ENGLISHnews todayNews Updatenews website latest NEWS photos videos news breaking news in ENGLISHnews websitesNGO IN INDIANGOsNicola GruevskinimhansNirmala SitharamanNISGniti ayogNobel Peace LaureateNoida Shaheed Smarak.Nokianokia newsnorth block of rashtrapati bahavanNorth Eastern Region MSMEs Conclave 2015northern railwaysnorthern railways newsNRDCnrinsdnsense mumbainse quotesnsgNSS VolunteersNTPCntpc cmdNTPC K BISWALntpc ladies clubntpc ladies club newsntpc newsO.P. Kohliofficial directory of government of indiaOil & Gas Conservation FortnightOil & Gas Conservation Fortnight-2015oil psuOkram Ibobi SinghOliver-BaeteOm Prakash Dhankaromar abdullahOommen Chandyorganised by the eminent artist Manav GuptaP. RadhakrishnanP.C. Agarwal Secretary HKNSP.V. RajagopalPacific Fleet US NavyPanchayati RajparliamentParliament HouseParliament newsparliament of indiaparliament of india newsParliamentariansParliamentarypassportpassport applicationPATNA NEWSPaul PolmanPay CommisionPCSPedro Morenes EulatePenny PritzkerPeoplePersonnelPETROLEUM MINISTRYpgcilphone directoryphone number of indian govtphone numbers of government of indiaphone numbers of indian government employeesPinaka 214 MM Multiple Barrel Rocket Launcher SystemPiyush GoyalPlenary Session III of Youth Pravasi Bharatiya Divas 2015PMNRFPMO Mobile App developmentpnbPNB DOCUMENTARY FILMPNB DOCUMENTARY FILM VARDAANpnb ed gauri shankarPNB EXECUTIVE DIRECTORPNB PrernaPNB supported Hind Kusht Nivaran Sangh for leprosy eradicationpoland newsPOLICE COMMISSIONER B S BASSIpolice commissionerspolice commissioners listPoliciesPolicyPOLIO DROPSpolio in indiapoliticalpolitical newspolitical news of indiapolitical parties in indiapolitical sitespolitical websites of indiapoliticspolitics newsPopulationport blairport blair newsposcopower gridPower Grid Corporation of India Limitedpower persona of the year awardspower psupower psu newsPower Solutionspowerful bureaucrats of indiaPrakash MishraPravasi Bharatiya DivasPravasi Bharatiya Divas 2015Pravasi Bharatiya Samman Awardspremier banks of indiapresident assochampresident ficciPresident Gorkha Brigade and Colonel of the Regiment 5 Gorkha Riflespresident of india administering polio dropsPresident of World BankPresident's EstatePress Information Bureauprime minister national relief fundPrime Minister of Bhutanprime minister of indiaprime minister of polandPrime Minister's NCC RallyPrime Minister's Officeproducer Dinesh VijanProf. (Dr.) Ram Shankar KatheriaProf. Anjan Ananda SenProf. Kaptan Singh SolankiProf. Mohammad MiyanProf. Ram ShindeProf. Sanjay JhinganProf. Ved PrakashProf. Vijay K. ChaudharyProfessor of Head Department of BiochemistryPSupsu chairmans listpsu ntpcPSU of indiapsu updatePublic Grievances & PensionsPublic Healthpublic relation officers of PSUpublic sector undertakings of indiapulse poliopunab national bankPune DGAFMS Lt. Gen BK. ChopraPunjab National BankQuarterdeck bookQUARTERLY FINANCIAL RESULTS OF NATIONALISED BANKS OF INDIAR.K. MathurR.K. Tyagi former hal chairmanR.S. SharmaR.V. College of EngineeringRaahgiri Day for Persons with DisabilitiesRaahgiri Day for Persons with Disabilities in delhiRadha Mohan Singhrahul gandhiRail Bhavanrail bhawanRailway BoardRailway Board & Ex-officio Secretary to the Government of Indiarailway board membersrailway budgetrailway budget newsrailway ministryrailways newsRaipurRajasthanRajasthan Directoraterajasthan government newsrajasthan Suratgarh Military StationRajeev KherRajendra RathoreRajesh Agarwalrajiv gandhiRajiv Pratap RudyRajive Kumarrajnath singhRaksha Mantri Padakram naresh yadavram vilas paswanRamakrishna MissionRan of KachchRao Inderjit SinghRaosaheb Dadarao DanveRashtrapati Bhavanrashtrapati bhavan newsrationalravi shankar prasadravindra singhRBIRedesigned Websites of the Ministry of PowerRegulationsrenowned scientists of indiaREPUBLIC DAYRepublic day newsrepublic day of indiarepublic day tableau of the Ministry of Indian RailwaysRepublic of South AfricaREPUTED FASHION DESIGNERS IN INDIAreserve bank of indiaResource centerreutersRICHARD RAHUL VERMARiver Development and Ganga RejuvenationRoad Safety and Safe Mobility InitiativesROAD SAFETY WEEKROBERT VADRArpfrs chief mohan bhagwat controversial statement on Mother teresarss chiefruling powerRural and Maritime DevelopmentRural DevelopmentS. Iswaransacred bodhi plantSadhvi PrachiSalma Ansarisalman khansamacharnewssamadhi of mahatma gandhisamajwadi partsamajwadi partysamchar4mediaSankranti MilanSANTANU SAIKIAsantosh kumar gangwarSarbananda Sonowalsarkarisarkari babussarkari babus of indiasarkari bodiessarkari bodies of indiasarkari jobsarkari naukrisarkari newssarkari officialssarkari phonesarkari phone directorysarkari phone numberssarkari resultsarkari websitessarkarimirror.comsarkaritelSaurabh Chandrasaurabh chandra petroleum secretarySBIscientists of indiascope directorySCOPE HR Summit 2015scope hr summit newsscope newsscope telephone directoysebiSecond Session of the UNESCAP Working Group on Asian and Pacific Decade for Persons with DisabilitiesSecretary (Health)secretary amitabh kantsecretary ashok lavasasecretary indiasecretary of indiaSecretary of Ministry of Skill Development and EntrepreneurshipSecretary of Ministry of Skill Development and Entrepreneurship Sunil AroraSectorssecuritysenior Government representatives from 15 countries and 15 Civil Society Organizations in the Asia Pacific RegionSergey NaryshkinSesquicentennial function of Advocates' Association of Western IndiaSHAHRUKH KHANShaikh Khalid Bin Mohamed Al Khalifasharad pawarSharda UniversityShatrughan SinhaShivraj Singh ChouhanShri Anant Kumar SinghShri Arun Jaitley briefing the media about the deliberations of the first meeting of the Governing Council of NIITI Aayog chaired by the Prime MinisterShri Narendra ModiShri Raman SinghShri Rao Inderjit SinghShri Shingaji Thermal Power ProjectSIATSIDELINED BCCI CHIEFsigning of the agreements between Kamarajar Port Ltd. and Toyota Kirloskar motor Pvt. Ltd.Sikh RegimentsingaporeSir Ashutosh Mookerjeesir ganga ram hospitalSir Nicholas Patrick CarterSmall and Medium Enterprisessmriti iraniSneh Lata KumarSocial Justice & EmpowermentSocial MediaSocial securitySoil Health Cardsonia gandhisouth block of rashtrapati bhavanSpanish Defence Ministerspeaker of lok sabhasportssports news top sports newsSri Sri Ravi Shankarsrinagar newsSRKStage I of Shri Shingaji Thermal Power Project to the nation at KhandwastateSTATE BANK OF INDIAState Civil Servicesstate government newsstate government of indiastate governments of indiaStatesStatisticsStatus of Tigers in India 2014stiture Parade of Railway Protection Forcestock exchange of indiaSTYLIST AAMER ZAKIRSudarshan Bhagatsudhir bhargavasunil arorasupreme court of indiaSupreme Head of the Universal Syrian Orthodox ChurchSuratgarh Military StationSuratgarh Military Station in rajasthanSuresh Prabhakar PrabhuSuresh Prabhakar Prabhu launching a ‘Customer Complaint Web Portal and Mobile Application’sushma swarajswachh bharatSwami Shantatmanandaswine flu in Telanganasymbiosissymbiosis universitysymbiosis university puneSymposium on International Automotive TechnologyT. R. ZeliangT. Suvarna Rajutableau of cpwd republic dayTableaux ArtistesTableaux Artistes republic day parade 2015Takehiko NakaoTARUN TEJPALtaxTechnologyTechnoogytehelkaTELANGANA NEWSTelecom Servicestelegram sent by USA to the Indian Constituent Assembly in 1946telephone directory of governmenttelephone directory of government of indiatelephone directory of government officials of indiatex trends fairtex trends fair 2015Thaawar Chand GehlotThe Ambassador of Poland to IndiaThe Ambassador of the Republic of KoreaThe Ambassador-designate of United States of Americathe Calcutta High Court Chief Justicethe Central Adoption Resource Authoritythe Central Board of Excise and CustomsThe Chairmanthe Chairman of State Dumathe Chief Advisor to President of Islamic Republic of Iran and Secretary of Council for Free TradeThe Chief Economic AdviserThe Chief Election CommissionerThe Chief Minister of Biharthe Chief Minister of ChhattisgarhThe Chief Minister of DelhiThe Chief Minister of GujaratThe Chief Minister of HaryanaThe Chief Minister of Himachal Pradeshthe Chief Minister of Madhya PradeshThe Chief Minister of MaharashtraThe Chief Minister of ManipurThe Chief Minister of NagalandThe Chief Minister of PuducherryThe Chief Minister of RajasthanThe Chief Minister of TripuraThe Chief Minister of Uttar PradeshThe Chief of Army Staffthe Chief of Gen. Staffthe Chief of Naval Staffthe Commerce MinisterThe Commerce SecretaryThe Defence SecretaryThe DG NCCThe Director General AADthe Director General Coast GuardThe Director of the International Department of the Central Committee of the Communist Party of Chinathe election commissionerthe ENDOLAP 2014- Third Biennial International Conference and Advanced Live Laparoscopic WorkshopThe Finance Minister of Republic of Turkeythe Foreign Minister of BahrainThe former Chief Minister of J & KThe former Director of Indian Institute of ScienceThe former PresidentThe former President of MaldivesThe French Defence Ministerthe General & Census CommissionerThe Global CEOThe Governor of GoaThe Governor of Gujaratthe Governor of Haryanathe Governor of Jammu and Kashmirthe Governor of KarnatakaThe Governor of Madhya Pradeshthe Governor of West Bengalthe Health Ministerthe highest gallantry award Ashok ChakraThe Indian Boxerthe Indian Constituent Assemblythe Indian Machine Tool Manufacturer’s Associationthe International Mother Language DayThe Jr. Commanderthe Krantiguru Shyamji Krishna Verma Kachchh Universitythe launch of the National Deworming initiativeThe Lt. Governor of Andaman & Nicobar Islandsthe Minister for Agriculturethe Minister for Minority Affairs of Maharashtrathe Minister of CultureThe Minister of Defence and General of Army of Russia Sergey K. Shoyguthe Minister of EducationThe Minister of Foreign Affairs of JapanThe Minister of Health and Medical Services of Fijithe Minister of Industry and Tradethe Minister of Industry and Trade Czech Republic Jan MladekThe Minister of International Relations and CooperationThe Minister of Labour of CanadaThe Minister of State (Independent Charge) for Powerthe Minister of State for Chemicals & FertilizersThe Minister of State for Commerce & IndustryThe Minister of State for Consumer AffairsThe Minister of State for Culture (Independent Charge)The Minister of State for FinanceThe Minister of State for Heavy Industries & Public EnterprisesThe Minister of State for Home (Rural)The Minister of State for Home Affairsthe Minister of State for Human Resource DevelopmentThe Minister of State for Information & Broadcastingthe Minister of State for Labour and EmploymentThe Minister of State for Labour and Employment (Independent Charge)The Minister of State for Micro Small & Medium EnterprisesThe Minister of State for Minority Affairs and Parliamentary AffairsThe Minister of State for Petroleum and Natural GasThe Minister of State for Petroleum and Natural Gas (Independent Charge)The Minister of State for Planning (Independent Charge) and DefenceThe Minister of State for Railwaysthe Minister of State for Road Transport & Highways and ShippingThe Minister of State for Rural DevelopmentThe Minister of State for Science and Technology and Earth ScienceThe Minister of State for Skill Development & Entrepreneurship and parliamentary affairsthe Minister of State for Social Justice & Empowermentthe Minister of State for Statistics and Programme Implementation (I/C)The Minister of State for Urban Developmentthe National Deworming initiativethe National Librarythe National Science Day Lecture on “Science for Nation Buildingthe North Eastern Region MSMEs Conclave 2015The Parliamentary State SecretaryThe Peranakan World - Cross Cultural Art from Singapore and the Malacca Straitsthe presentation of Standards to 21 SQN & 116 HU of Indian Air ForceThe President Asian Development BankThe President of the Association of Biotechnology Led EnterprisesThe President of the Democratic Socialist Republic of Sri Lankathe President of the Republic of SingaporeThe Prime Minister of Macedoniathe Railway Budget 2015-16the Raksha Mantri’s Trophythe Second Minister for Trade & Industry of SingaporeThe Secretarythe Secretary (BM)The Secretary Ministry of Culture Ravindra SinghThe Secretary Ministry of TourismThe Secretary Ministry of Tribal Affairsthe Secretary of Delhi Ramakrishna MissionThe Spanish Defence Ministerthe State Level Khadi Gramodyog Exhibitionthe State Level Khadi Gramodyog Exhibition in guwahatiThe tableau of GoaThe tableau of Goa on rajpathThe tableau of Goa on rajpath on republic dayThe tableau of Indian NavyThe tableau of KarnatakaThe tableau of Maharashtrathe tableau of ministry of railwaysThe tableau of the Department of Financial ServicesThe tableau of the Department of Financial Services at republic dayThe tableau of the Ministry of Indian RailwaysThe tableau of the Ministry of Indian Railways on rajpathThe Tennis PlayersThe UGC ChairmanThe Union Minister for AgricultureThe Union Minister for Agriculture senior officials of ICARThe Union Minister for Chemicals and FertilizersThe Union Minister for Civil AviationThe Union Minister for Communications & Information TechnologyThe Union Minister for Defencethe Union Minister for External Affairs and Overseas Indian Affairsthe Union Minister for FinanceThe Union Minister for Health & Family WelfareThe Union Minister for Heavy Industries and Public EnterprisesThe Union Minister for Human Resource DevelopmentThe Union Minister for Law & JusticeThe Union Minister for MicroThe Union Minister for Minority AffairsThe Union Minister for RailwaysThe Union Minister for Road Transport & Highways and ShippingThe Union Minister for Rural DevelopmentThe Union Minister for Social Justice and EmpowermentThe Union Minister for Tribal AffairsThe Union Minister for Urban DevelopmentThe Union Minister for Water ResourcesThe Union Minister for Women and Child DevelopmentThe US PresidentThe Vice Chairmanthe Vice Chancellor of Maulana Azad National Urdu University (MANUU)the Vice President of the Asian Development Bankthe Voters’ Day Pledge at Kamla Nehru Collegethinkedu conclaveThird Biennial International Conference and Advanced Live Laparoscopic WorkshopThiruvalluvar Daytimes of indiatimes of india epaperTofail Ahmedtokyo newsTomasz Lukaszuktop 10 news websites of indiatop 10 websites of indiatop banks of indiatop bureaucracy websitestop bureaucrats of indiatop defence newstop defence news websites of indiatop educational institutestop english news websitesTOP FASHION NEWS OF INDIAtop global newstop governance websitestop government newstop government news websitestop government news websites of indiatop indian political newstop indian political news websitestop international newstop news of indiatop news storiestop news websitestop news websites of indiatop political newstop political news in indiaTOP POLITICAL NEWS WEBSITEStop political sitestop political web sitestop political websitestop psu newstop ten news websites in the worldtop ten news websites of asiatop ten news websites of indiatop ten websites of indiaTourism (Independent Charge) and Civil AviationTourism and Marketing of MaharashtraToyota Kirloskar motor Pvt. Ltd.Trade &transportationtribal food festivalTshering TobgayTughlakabadtwo-day National Thematic Workshop on the ‘Best Practices for Women and Child Development’UdyanotsavUdyanotsav of mughal gardenUKuk defence newsUNUN Genral SecretaryUNAUDITED FINANCIAL RESULTS OF NATIONALISED BANKS OF INDIAUNDERGROUND RESERVOIRS OF DELHI JAL BOARDUNESCAPUnileverUnion Home Ministerunion minister for raiwaysUnion Minister for Road Transport & Highways and Shippingunited kingdom defence newsunited nationsunited nations general secretaryUniversity of Delhiuniversity of lucknowuniversity of lucknow convocationUPUP CMup cm akhilesh yadavUPA MINISTER KRISHNA TIRATHupdated government newsupdated newsUpendra KushwahaUrban Auxiliary Nurse Midwifeus ambassador to indiaus president arack Obama inspecting the Guard of Honourus president barack obamaus president during india visitUS Secretary of CommerceUS Secretary of StateUTUtilitiesUTsUwe BackmeyerVajubhai RudabhaiValedictory Session of the Pravasi Bharatiya Divas 2015VARDAAN DOCUMNTARY FILMvarun dhawanVasundhara Raje Scindiavibrant gujaratVibrant Gujarat Global SummitVice Admiral Anurag G. Thapliyalview of the illuminated Rashtrapati BhavanVijay SamplaVinayak Shah Marge & Dorabi Tata MargeVirbhadra SinghVisaVision 4G-India’s next Telecom Revolutionvisitor’s book at the Amar Jawan Jyotivoter id applicationvoter id cardvoters card list of indiaVOTERS DAYWang Jiaruiwater newsWencai ZhangWest Zone Cultural CentreWest Zone Cultural Centre Udaipurwhats happening in indiaWHITE DESERTwho is delhi chief ministerWHO IS THE CURRENT MD OF PUNJAB NATIONAL BANKWHO IS THE EXECUTIVE DIRECTOR OF PNBwife of vice president of indiaWildlife Crime Monitoring SystemsWinners of the National Bravery Awards-2014Wirelessworkshop on ‘Performance Evaluation and Management of State Owned Enterprisesworkshop on National Aviation Universityworkshop on Streamlining Government CommunicationWorkshopsworld best political newsworld best political news websiteworld best political news websitesworld breaking newsworld embassies indiaworld government newsWorld Leprosy Dayworld newsWorld Toilet Summit 2015Y.S. Chowdaryyair shamirYakovlevs - a four aircraft display team from UKYami GautamYelahankazeenewsZoological Survey of Indiazsi

Posts pagination

1 2 … 133 Next

Tarun Sharma, Editor-in- Chief

tarun sharma editor

December 2025
M T W T F S S
1234567
891011121314
15161718192021
22232425262728
293031  
« Nov    

Informative Links

SGRH LOGO
dmrc routes and fares
Screenshot 2020 07 08 10 21 51 637 Com.google.android.apps.docs
Proudly powered by WordPress | Theme: TimesNews | By Theme Freesia.